Conserved Protein Domain Family
PHA03357

?
PHA03357: PHA03357 
Alkaline exonuclease; Provisional
Statistics
?
PSSM-Id: 177595
View PSSM: PHA03357
Aligned: 2 rows
Threshold Bit Score: 100.066
Threshold Setting Gi: 9625923
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625923   1 MGQSSSSGRGGICGLCKRYNELVTCNGETVALNSEFFEDFDFdENVTEDADKSTQRRPRVIDVTPKRKPSGKSSHSKCAK 80 
13242442  1 MGQTTSTGRGGICGLCKRYNELVTSDGETLTLNADCFEDFDF-ETTNEAGNRPDFPKYNFSKPKNKKKLSKKTSNTLTCK 79 
9625923  81 C 81 
13242442 80 N 80 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap