Conserved Protein Domain Family
PHA03356

?
PHA03356: PHA03356 
tegument protein UL11; Provisional
Statistics
?
PSSM-Id: 177594
View PSSM: PHA03356
Aligned: 5 rows
Threshold Bit Score: 133.85
Threshold Setting Gi: 30984439
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
83722579  1 MGLAGSRVGPCCCRRNVLVTDRGETVSLTANEFDAVELESDAGGNFYISPELRVVTQPPAQQPPHPRGPPSRGDRHWSRS 80 
9629391   1 MGLSFSGARPCCCRNNVLITDDGEVVSLTAHDFDVVDIESEEEGNFYVPPDMRGVTRAPGRQRLRSSDPPSRHTHRRTPG 80 
9629280   1 MGLAFSGARPCCCRHNVITTDGGEVVSLTAHEFDVVDIESEEEGNFYVPPDVRVVTRAPGPQYRRASDPPSRHTRRRDPD 80 
56694733  1 MGLAGSRLGPCCCRRNVLVTDRGETVSLTANEFDAVDLESDAGGNFYISPELRVVTQPPS-QPPRPAGPPSRGDRHWSRS 79 
30984439  1 MGLAGSRAATCCCRRNVLVTEQGETVSLTATEFDAVELDSDAGGNFYISPELRVVTQPRP-QPPRRGGPPSRSGRHWSCS 79 
83722579 81 GRHPDHIHyptPPVVR 96 
9629391  81 GACPATQF---PPPMS 93 
9629280  81 VARPPATL---TPPLS 93 
56694733 80 GRRPGPTS-------- 87 
30984439 80 GQRPNPSNrppSPLMS 95 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap