Conserved Protein Domain Family
PHA03354

?
PHA03354: PHA03354 
Alkaline exonuclease; Provisional
Statistics
?
PSSM-Id: 177593
View PSSM: PHA03354
Aligned: 3 rows
Threshold Bit Score: 135.016
Threshold Setting Gi: 10834880
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12084839   1 MGQATSyLTDTFRRCCKRNILLTKSGQTIAIDRENYDSFNLDELRYTDYVEEAKIALLDRPIGIGKRINKNERDYTNHPI 80 
10834880   1 MGQAIS-VTELFRRCRKRNTVLTKTGHVIELDDEQYDTVDLDGLRSSDPLIHSDTVLAGSTCARGKTLFRFKDGREQCND 79 
125745062  1 MGQAVSyLTYTLRRCCKKNTLTTESGEVIELDDEHYDTVDLDDLRCSDPLMQPKFVLLKNG-RRGKRNREYDNDHEKYVM 79 
12084839  81 L 81 
10834880  80 T 80 
125745062 80 M 80 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap