Conserved Protein Domain Family
PHA03351

?
PHA03351: PHA03351 
tegument protein UL16; Provisional
Statistics
?
PSSM-Id: 177591
View PSSM: PHA03351
Aligned: 2 rows
Threshold Bit Score: 435.964
Threshold Setting Gi: 20026618
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52139202   1 MERRRGTVP---LGWVFFVlclsassPCAVDLGSKSSNSTCRLNVTELASIHPGETWTLHGMCISICYYENVTEDEIIGV 77 
20026618   1 MAKDRGSVPmmgIAWILFV-------GGCFGLIDLEKYSNCTYNATVMGERNVTETWTSTGICLSICYYSNVSDDEVLGV 73 
52139202  78 AFTWQHNESVVDLWLYQNDTVIRNFSDITTNILQDGLKMRTVPVTKLYTSRMVTNLTVGRYDCLRCENGTMKIIERLYVR 157
20026618  74 AFVSQYNESYTDAWLYKNGTEIRNFTVMQYNILQNGLQMRHVPWTKLYTHRIINNHTAGRYDCFRCKNGTLEIVERTYVK 153
52139202 158 LGSLYPRPPGSGLAKHPSVSADE--ELSATLARDIVLVSAITLFFFLLALRIPQRLCQRLRIRLPHRYQRLRTED 230
20026618 154 LGSLYKSLEEYRMMRHPSMSGEEdsEPPANLARDVMIVSGLTLLFFLLGMRIPQRLFQRLKLRFMFQRQRLRDGE 228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap