Conserved Protein Domain Family
PHA03349

?
PHA03349: PHA03349 
tegument protein UL16; Provisional
Statistics
?
PSSM-Id: 177590
View PSSM: PHA03349
Aligned: 19 rows
Threshold Bit Score: 356.656
Threshold Setting Gi: 51557526
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38638241    1 MRVSVSKIGTSCAERLLNDVNVWARVRNDPLLTILTAKMPLRKEYRRWfdgIEEDKPAAGADtsSLRIYLYLTKPKRSRG 80 
9625918    16 ARKLTPEAVQRLCDALTLDMGLWKSILTDPRVKIMRSTAFITLRIAPF---IPLQTDTTNIA--VVVATIYITRPRQMNL 90 
9629773    20 NRQLTIEAANCLTEALTEDIAVLRLIRSDPRVKIFMAVSVLTPRLARF---APPQSKLTHTAk-CAVIMIYLTRPKALAL 95 
9629860     1 MAEDPAAAGALLARALTEELGCLHLVRTDSRVKIYVAVATLGRLLARL---VSPEDASPGA---AVRVTLYITRPRSLEL 74 
13242437   17 ARILTPCAAERLTNALTLDMGLWKSVLTDSRVKIIRSTAFITSKIAPF---IPPPTLDSQHPg-VIIATVYITRPRQLNL 92 
12084844   15 FETFCGDMAVNFVNTLNDRACVWRTLRADSRLAVMSTVLALDRSFCMH---APPNTQEHKTK--WVEIFMYLTRPKSLCL 89 
50313288   21 NRQLTPEAVNCLTEALTEDVAVLRLIRSDPRVKIFMAVSVLTPRLARF---APPPPKLTHTAk-CAVIMIYLTRPKALAL 96 
216905900  20 NRQLTPEAVNCLTEALTEDIAVLRLIRSDPRVKIFMAVSVLTPRLARF---APPPAKLTHTAk-CAVIMIYLTRPKALAL 95 
255683200  34 GS-------VHLARALNTQVCSWRLIRSDSRIKIMIAITALGDRLCAF---APPLEDRERAA--MVEIILYLTRPKALAL 101
270339483  15 ERRLTQDAVELLIEALSDDICSLKPIRSDSRIKIYKGVGLLTPRLAPF---TPAPSQLSSIKnyCVSVTLYITRPKALKL 91 
38638241   81 GRRNVHITAVVNGAHAFCLLSRMGAEKSPLGGETFCIRvSKSKLCPTPLEDLPDPRNEPVPSQILP-ADYTSLTSKAIPP 159
9625918    91 PPKTFHVIVNFNYEVSYAMTATLRIYPVENIDHVFGAT-FKNPIAYPLPTSIPDPRADPTPADLTPtPNLSNYLQPPRLP 169
9629773    96 QPKQFHVLVTFSKSSVYSLVMRVKTKPFPISPQRFCGV-FQDPEPIGLPSDVPNPATENIPTEINDrLDVSNFATQTQPP 174
9629860    75 PPRHFHVLVLFGGAVARACVAGVRTRALVPGSTRVRAV-FRDAVAVPAPADLPDPSAEVVPPAPAEhVDPFAFTAFARPP 153
13242437   93 PQKHFHVIVNFNYEISYCLTALLRIYPIDGMDNVVGAT-FGEPTALALPECIPDPRADPTPVSNDAyVNLNNYLQAPRLP 171
12084844   90 CRKAFYILFVINGVRLYSITSTLHIVPLRHKEGSADIIhFSGVSPADLPLVLPDVANEPLPPPPAMvPDIDALAERDRPP 169
50313288   97 QPKQFHMLVTFNKASVYSLVVRVKTKPFPVGTQRFRAV-FQDPEFIGLPSDIPDPAAENIPTEINDrLDVSNFATPAQPP 175
216905900  96 QPKQFHVLVTFNKASVYSLVVRVKTKPFPVGPQRFRAV-FQDPEPIGLPSDVPNPAAENIPTEINDrLDVSNFATPAQPP 174
255683200 102 PSGTFHAVFIVNRSSMYAAIAAIHIEALNQSGTLFSLL-FSSVETTPPPPEVPDPSTEIMPQAPASiLNLEDHTENITPP 180
270339483  92 SKGQFHILALFGISTAYAFISNVILKPMLPDSTILGAS-FYDASAIPLPKEVPDPTAELIICDDPLhLDVSMFATPAQPP 170
38638241  160 LDPEWCVCLSPGAWWHYPTETVFFFHLKDIMKSICPAGWNSMTFCAILTAFLDPKPRnCDLRRdtRRRHVDQFGNTDG-P 238
9625918   170 KNPYACKVISPGVWWSDERRRLYVLAMEPNLIGLCPAGWHARILGSVLNRLLSHADG-CDECN--HRVHVGALYALPHvT 246
9629773   175 KDKYDCCVLAPGVWWYKAQKAIYFLQMDEALLALCPAGWKARGLGIILGRLLNHQEG-CSTCR--FTEHSDPLNATADsV 251
9629860   154 RDAADCFQLAPGVWWSYADRRLYLVQMDEALLALCPAGWRSRSLGGVLGRLLSHPGG-CAACT--AKWHIDALNAAPEpG 230
13242437  172 KNVYACKMLSPGVWWSDEKKRLYVLAMDSQLLGLCPAGWQTRILGAVLGRLLSHSNG-CSECY--GRKHVGSLLATPTvP 248
12084844  170 EDPDVCITVSIGAWWSISQRKFYYLRMEESLLAICPAGWQQRSLGATLAKFLDHENG-CRQCNshDSSHLDVYGGSWGcG 248
50313288  176 KDKYDCCVLAPGVWWSNANKAIYFLQMDVALLALCPAGWKARGLGIILGRLLNHQEG-CATCR--FTEHSDPLNATADsV 252
216905900 175 KDKYDCCVMAPGVWWSNADKAIYFLQMDVALLALCPAGWKARGLGIILGRLLNHQEG-CATCR--FTEHSDPLNATADsV 251
255683200 181 RDPHNCRMVSVGAWWSFPKRRLYYLRMDTPLLAICPAGWKARTLGDVLARLVDHTPG-CETCIs-GHDHVDSYNAIWKpG 258
270339483 171 DQRYDCCVLAPGVWWSYRECSIYYLCMDTTLLALCPSGWRCRSLCGILARLLNHREG-CGLCQ--FEGHVDALNASSEpS 247
38638241  239 GA-ELFCPCKVPCHNEDGPRRTpLRPRGEQNLLKLLFVGHVETVTQLqHACEPGyIPGDVSRVIRGNGADGRRVPPNCQA 317
9625918   247 NH-AEGCVCWAPCMWRKAGQRE-LKVEVDIGATQVLFVDVTTCIRIT-STKNPR-ITANLGDVIAGTNASGLSVPVNSSG 322
9629773   252 AT-PESCLCWAPCLWRKSRQRE-LKVEGDRYLFRVLFMDAVERVRLTgLRRSPK-ITADLADLVVGIGSHGQQIPVNSAG 328
9629860   231 AC--DVCPCAAPCLWKKARRQD-VPVAGDSSLFRVLFTDAVARVRILgSRRRPR-ITGALPELLAGVGPRGEAVPVNGAG 306
13242437  249 NH-TESCVCWAPCMWRKAGRRD-LKVQGDIGNTQVLFMDAVTSIRIIsSNKNPR-ITSNLSDIISGTNISGMSIPANVSG 325
12084844  249 TV-GHACLCKGPCMWMKARQTE-LPVEGDTSLYCVLFMGMVKSVKLMiAENSK--ITDRLEDIIVAGGACCN-TPVNSCG 323
50313288  253 AT-PESCLCWAPCLWRKAHQRE-LTVEGDRYLFRVLFMDAVERVRLTgLRRSPK-ITANLADLVVGIGPHGQQIPVNNAG 329
216905900 252 AT-PESCLCWAPCLWRKAHQRE-LTVEGDRYLFRVLFMDAVERVRLTgLRRSPK-ITANLADLVVGIGPHGQQIPVNSAG 328
255683200 259 EV-AEACLCKGPCLWLKSKQRD-MIVEGDVSMCRVLFMDAVDTIRLV-SNRNPR-ISANLAEVISAFGSARQ-VPVNAAG 333
270339483 248 NIpPESCLCWAPCLWRKAGQRD-LPVEGDHVLFRVLFMDAVDRIRLPgSPRNPK-ITNNISDVISGIGSDGRQIPANGAG 325
38638241  318 WDLLKFTQFASRSLLCGCPEMRRIVDDAADSSWLR 352
9625918   323 WQLYMFGETLSRAIINGCGLLQRICFPETQRLSGE 357
9629773   329 WKLVALDANISKLIVCGCYSLRYLCPSTDCKTQQL 363
9629860   307 WQLRVMDDDVTRLLASSCRAMRSCAAARGSPWG-- 339
13242437  326 WQLYMFGESVSRAIINGCALLQRLCHFSYKSNETH 360
12084844  324 WHLVSLPTNWSMLMIQGCIKLPRLCYIS------- 351
50313288  330 WKLVALDADISRLIVCGCYALRYICPPTNSKHQPS 364
216905900 329 WKLVALDADISRLIVCGCYALRYICPLTNSKHQPS 363
255683200 334 WHLVALSEIASSIMISGCARLRRLCYPKT------ 362
270339483 326 WNLVVLDENITKALICSCFHLRRLCMDSPPSDNIS 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap