Conserved Protein Domain Family
PHA03348

?
PHA03348: PHA03348 
tegument protein UL21; Provisional
Statistics
?
PSSM-Id: 177589
View PSSM: PHA03348
Aligned: 18 rows
Threshold Bit Score: 571.955
Threshold Setting Gi: 51557520
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
296316040   1 MEFAYRSVVAHNGVSFYVPAAGDVAYFVYAGTVVSVARG------GGEAVKFGLELRGPRRGDRAVAGYTRAELARAAGP 74 
270339478   1 MEFKYHDTMVSRGVLFYIADNGNRIYFTHGGCLISVQRPqs--knRPEIAKFGLTVRGVGEGDRLVANYVRSELNNTGRG 78 
216905894   1 MDFKYSDTVIHNGVVFYITDGGHRVYFLYGGCLLSVPRPhat-seSGEIAKFGLTLRGLTHNDRVVANYVRSELNRTGRH 79 
149999618   1 MDIKYEQMILYKNVKFYVAPGGHQAYFFCGGSLIAMERPvygstcVAEFAKFGLVLGG--GECKPLAAYIRRELSRRGMK 78 
125745072   1 MDIKYGHVLAYRNVQFYVSECGYKAYFFCGGCLFAVGRPriddeyLPELAKIGLVLRG--GQSKPLAAHVRRELLRRGMK 78 
51557520    1 MEFEYQSTIVHQGVLFYVADGGDRAYFVHGGCIVSVHRR------SREIGKFGLTLRGNAPGNRVVANYVRTELARLGRA 74 
50313282    1 MDFKYSDTVIHNGVVFYITDGGHRVYFLYGGCLLSVPRPhat-aeSGEIAKFGLTLRGLTHNDRVVANYVRSELNRTGRH 79 
10834890    1 MDIKYEQKILYRNVHFYISECGRIAYFFCGGCLMAVGRPptd-dsQAEFAKFGLALRGDG-ESKPLAAYVRRELLRRGMK 78 
9629854     1 MELAYHSVVAHNGVSFYVSAAGDVAYFVYAGTVVSVARR------GGEAVKFGLELRGWGRSDRAVANYVRAELARAVPL 74 
9629768     1 MDFKYSDTVIHNGVVFYITDCGHRAYFIYGGCLLSVPRShaa-peSGEIAKFGLTLRGLKLNDRVVANYVRSELHRTGRH 79 
296316040  75 LAPAAGAADngdpdgggVFVDCLARLRPrgGAPAAGADLCGRFDVPVGDPYLAECFVSLGVASGLVLTTGYHDTERRVLH 154
270339478  79 WAVPQTDED--------VFLDKVDLLSH--GPDVSDRDLCGGFELEIYDQYLTECMVSLKVSSGIVLTTGRDLPQDGTLR 148
216905894  80 ESAPSSEED--------VFVDRLEVLAQ--GAQAFGRDICGSFELEVYDPYLAECMVSLKVTSGLIVSTGRDIPQDGTLH 149
149999618  79 WALPSEGED--------IFVDCLAMLSR--DGICSERELCGDLSLETYDPAITNYIVSESGVSGLLLCMADDSSEENTIH 148
125745072  79 WAFSSDEDE--------LFIDSIAVLSR--DGICSERELCGLLCLETYDPDIAKYMVPTNAISGLTIQAAYDFPHDRTIH 148
51557520   75 WAAPQGSDD--------VFVDALGLLLP-----LTELDLCGRAELDVYDPYLVECMVSLPASA-LSLTLVHDRQQDRVLE 140
50313282   80 ESAPSSEED--------VFVDRLEVLAQ--GAQAFGRDICGSFDLEVYDPYLAECMVSLKVTSGLIVSTGRDIPQDGMLH 149
10834890   79 WALPPGDDE--------LFIDCMAFLNL--DGACSEREICDLVCLETYDPEITKHMVSTNVISGLLIQTAHESPRDCVIH 148
9629854    75 APSGATDGEddpd-gggAFVDCLARLRPrgGAPAAGADLCGRFDVPVGDPYLAECFVSLGVASGLVLTTGYHDAERRVLH 153
9629768    80 ESAPSSEED--------VFVDRLEVLVQ--GTQAFGRDICGSFDLEVYDPYLAECMVSLKVTSGLIVSTGRDIPQDGTLH 149
296316040 155 LFDVPTITNALSGFVYAPNRECFALMQACLPAPPAPARPLLRGLFERVAAEAGRGSGadgvgeDARPPATEVIVTAARAA 234
270339478 149 LFEVPTITNASSGFVYTPNRSCFRLIQAYLSELPKALEELIDGLFDGIPCPRLPING------DEPPITTDVIVTSKRAV 222
216905894 150 LYTVPTITNASSGFIYTPNIACFTLVQAYLTELPPELETLISGLFDRIPVARPPLRDe-----SEGHSRTDVIVTSPRAV 224
149999618 149 LSETPTVTDLHTDCTYDCNRNVFTLAYARLTELPNSLHYLVEGLFDGIPVPRLPLSP------NTHKTRIDIVITAKTAA 222
125745072 149 IPEFPIITDIYSDLVYECSRDAFVLTCARLTELPKSLSDLVEGLFDGIPTPREALSS------EIFGRRVDVIVTAKKAA 222
51557520  141 LLAEPAIVHPSSGFVYAVNEACFALVQAYLSELPSSLQVLTEGLFDGIPGVRPPLSG--------ETRPTAVVVKGGRAA 212
50313282  150 LYTVPTITNASSGFIYTPNIACFTLVQAYLTELPPELETLISGLFDRIPVARPPLRDe-----SGGHSRTDIIVTSPRAV 224
10834890  149 LPGAPQVTDAHSNAVYECNSGAFVLTCATLVELPTSLNDLVEGLFDGVPIPRDALSS------RSLSRRTNVIITSTKAA 222
9629854   154 LFDVPTITNALSGFVYAPNRECFALMQACLRPRRGPCAPYCAGFLSR-RCRGGLRRGagegadARSPATTEVIVTTAR-- 230
9629768   150 LFTVPTITNAASGFIYTPNLACFTLVQAYLNELPQELDTLVSGLFDRIPVSRPPLRDe-----LERHSRTDVIVTSPRAV 224
296316040 235 GVRRVGagaddgg---agphaagAGGKKRPPGRRGAAVSNFVQVRLIPRTHNAWAVAAPPSRGDdPLPRLCAVVRCADAV 311
270339478 223 PAMAVR-----------------PTHYATRALRRDMIISNFVQVRYIPKPSNIWDPRDRASGVN-SIQVLCALIQRVDEI 284
216905894 225 KTMAIG-----------------GKTRCSKRPLRKTVVSDFVQVRLIPKPCSIWDSSGRVASGA-SLQSLQLLFKIADEI 286
149999618 223 KTTAVKrtswqrd---rsqngmaLNGNSTQHALKKTRFCTFVQVKYIPRTIRIWTRESSQSRSPpPLNKLWELFCTIDLV 299
125745072 223 NTTTVQrawdilqhgcrgklnvnSNRTNPVQRKKHARFSSFVQIKYIPPVFKIWSCDTSSCMPStSLNKLWEIFWKVDSV 302
51557520  213 PTLSV------------------RPRRYAERALRATVVSDFVQVRYIPATRRIWATRGGSL----SLQMLCDLVAGADAI 270
50313282  225 KTMAIG-----------------GTTRCSKRPLRKTVVSDFVQVRLIPKPCSIWDSASRVASGA-SLQSLQLLFKIADEI 286
10834890  223 ETTTIQrmhvprh---kqrgnlnTIAATLRPVKKHARFSPFVQVKYIPRVLKIWSCDSDSHSPS--LKELRELFCKVD-- 295
9629854   231 -----------------------AAAFAPPQARREAAVSSFVQVRLIPRTYNAWAMTGPPLSAA-TPCRGCVPSCCADAV 286
9629768   225 RTMAI------------------GTTNGSKRTLRKTVVSDFVQVRLIPKPCSIWNSSSKSASGA-SLQSLQLLFKLVDEI 285
296316040 312 -------VLKS-DHWAGIDETLNEARGDLVRATAALFGPRGRRGFVGE-SVADYGFSFCQRFALCQFLLSRWGMASCYGA 382
270339478 285 -------LSID-DCWDGLDDELNESRSTINTAISALFGETGEKPFLGArSSAGNKITPAQRFVLCQFIFMRWNLFNCYAT 356
216905894 287 -------ILIE-EPWPGLDEHLNQARSTIVDAVLAVYGNEGKLRFFGG-KLTQQGVTTLQRFVLCQFILGKWNLINCYAA 357
149999618 300 -------FRNEsRMIAGMEVAMGALVDEVAIISDVLFGRHA-PVFIGH-GSGYKTVSPTQKFLLLQYVNKLNGMPNCFGL 370
125745072 303 fnmnmlnLNSNlYTENGSQSDLEIIQSELGMISNALFGRHAS-MFVGV-GPENKNISPSQKFLLLQYIHILNRLPNCYDL 380
51557520  271 -------LRRAaGASDDASAAVVEAVSAVAA-----------DPFFGT---GSTSLTGAQRFALYQFILARWHLPSCYAA 329
50313282  287 -------ILIE-EPWPGLDEHLNQARSTIVDAILAVYGNEGKLRFFGG-KLTQQGVTTLQRFVLCQFILGKWNLINCYAA 357
10834890  296 -------MVRReNMYAESQLEPESVTSELVLIVDTVFGRPLA-PFIGV-GSENIRVSHFQKFLLLQGVLILNRLPNCYGP 366
9629854   287 -------VLKS-DHWAGIDETLNEARGDLVAAATALFGPRGRRGFVGE-SVADYGFSFCQRFALCQFLLSRWGMASCYGA 357
9629768   286 -------ILVE-EPWPGLDDHLNQARSTIVDAVLAVYGHEGKLRFFGG-KLTQLGITTLQRFVLCQFILNKWNLINCYAS 356
296316040 383 LEHLAESYVANYPHRAAAPLD-----------------EGTVADAANDVLRELCALGRFAEALARADPGEPPaptparga 445
270339478 357 LERLSDSYSRAFSTPEPKPGD-----------------VHTTLDAVNDLLGEGAILGKLSVLIFYMQLHPMI-------- 411
216905894 358 LEQLAESYIGAVPEARDPLPD-----------------PHLVADAVNEIIRESGILGELCEIIVRCTQPTDP-------- 412
149999618 371 LSEICHQYQPGVEKESPQSML-----------------DSVLVDMVNSMYKTAVFVGIAAEVVGAWMPASPDe------- 426
125745072 381 IRELCDHHTSTIEGECPTAMP-----------------DCALADMTNSLFRAILFLGMATEIVVNWMPSSLEe------- 436
51557520  330 LEGMLDRLDERPGAGAGDDDDddggegggggghggsraASAVAHAVNRVLREATVFGEVMRMLVNAAVVHAPaiad---- 405
50313282  358 LEQLAESYIGAVPEARDPLPD-----------------PHLVADAVNEIIRESGILGELCEIIVRYTQPTDP-------- 412
10834890  367 LRELCIQHAPAGEESPPLVSD------------------SVIADMANHMFRVAVFIGMVVEIVAGCVSFASEe------- 421
9629854   358 LEHLAESYAANYPHRAAAPLD-----------------EGTVADAANDILRELCVLGRFAEALARADLGEPPapaekgga 420
9629768   357 LEQLVESYIGAVHDACDPLPD-----------------PHLVADAVNEIIRESAMLGDLCEIIVRYTHSNTP-------- 411
296316040 446 ggggsggdgdsdgdGDDAAARALDLEMTAVLSLASRHTRRRItETGSADELRRVEGHIRAMLVHLYAGGGLPELARALAR 525
270339478 412 --------------GYKQFSPTVEKEAEMLTLFTAEHEKKNT-QFLMVDELRRVDFEIAKLLDALFSGGGIDGCALAACR 476
216905894 413 --------------VNGSGSEVVELEARLLAEFAANATRVEL-GLSSYDEARNMEARIASVLNKLYAKDGIGGAAQVACR 477
149999618 427 -------------lEMQSPSAVAFGDSTVLLDITDN-------TAVSDDTRKIKVHKLALILDQIYRGADIVATAWKESS 486
125745072 437 -------------pTSRVPSPSAFADATTLLDVAE--------TSAPKSIQDLKIRKLALILDGLYKDIDPIDVALRESV 495
51557520  406 -----------pagASPPTTKHAREDAATGLELAVMMSDAET-NAPDADACELVEAAGARVLDGLYAGRGLVAATAPVGR 473
50313282  413 --------------VNGSGSEVVELEARLLAEFAANATRVEL-GLSSYDEVRNMEARIASVLNKLYAKDGIGGAAQVACR 477
10834890  422 -------------lETRFPSATAFTDAGILLNGIEA-------SPKPNCLSELKTRKLALILDGIYRDMDPIDVALQESV 481
9629854   421 ggdgggydydcdcdDAAAAARALDLEMTAVLSLASRHTRRRIvETGSADELRRAEGHVRAMLLHLYAG-GAAGAGARARD 499
9629768   412 --------------VNGSFSEVVELEANLLAEFAANSTRVEL-GLSSFNESNEIKAKIASVLNKLYAKEGIGGAAQSACR 476
296316040 526 ALGTAAPYVTLIEAEQLTAFDRAPAARHGVRYLRALVNRRLGVAGITPPSD 576
270339478 477 SIRNAVPVYLAMAMKSITAFDIHEDAARGAQFIYKLVTRRLRLGGCSGFDK 527
216905894 478 ILGSGLPVAIVLSVSSITAFDSLDLSRKGAYYLYYLLSERLKRGGVTVHVN 528
149999618 487 YMDTSNLLCAAIDVSLLTAFEKSEGYSEYMRHIISLIDVRLKDAGCDTICL 537
125745072 496 GEDTAELLCAAIDISVLSAFEHWGYYSRYMQCIISLIDTRLRNSGCITICS 546
51557520  474 ALRPTSAVCA--EAALLTAFGDSPAALRGAQYLFQLFRARLTRANISIVLN 522
50313282  478 ILGSGLPVAIVLNVSSITAFDGLDLSRKGAYYLYYLLSERLKRGGVTVHVS 528
10834890  482 GLNTAELLSAAIDISVMSAFEHSGWCSGYMEHFVSLLDARLREGGCLAIFR 532
9629854   500 ALGTAAPHVTLMEAEQLTAFDRAPAARHGVCYLRALVDRRLGAAGITPPSD 550
9629768   477 MLGSGLPVAIVLNVSLITAFDNLDLSRKGAYYLYYLLSERLKRGGVTVHVN 527
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap