Conserved Protein Domain Family
PHA03347

?
PHA03347: PHA03347 
uracil DNA glycosylase; Provisional
Statistics
?
PSSM-Id: 177588
View PSSM: PHA03347
Aligned: 13 rows
Threshold Bit Score: 467.99
Threshold Setting Gi: 139472838
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9628049     1 MERWLQLHVWsKDQQDQDQEHllDEKIPINRAWMDFLQMSPFLKRKLVTLLETVAKLRTSTVVYPGEERVFSWSWLCEPT 80 
10140967    1 MEEWLRKHMW-PALPDHQHHP--SYDILLAEPWVQFLDMTPFFRQKLYNTLSKINEMRKSCIIYPPQAEIMSWSYLCAPE 77 
9631237     1 MDKWLQREIW-SKVQSIDRTS--NESLLISPDWLEFLQMSPFLKQKLLNLLNCVKEQRKKTVIYPPDDRIMFWSYCCAPK 77 
13095623    1 MNTWLQKVVWdNSTVEQETVT--DSDLLISRPWLEFLQLSPFMKQKLLTLLNNIKKLRQTTVIFPPTDRIMYWSYLCEPQ 78 
9629613     1 MDTWLKTHVWsLNVMQRDSVM-----DFLPQSWIDYLQLSAFSSKKLEQIMAAVENRRKQNIVYPDSEDVMRWAFSCPPE 75 
9626002     1 MDNWLKQEIW-SKTQHQDITS--DDCLLLSTDWVEFLQMSQFLKQKLLQLLNCIKEKRKKAVIYPPDNKIMFWSYCCAPR 77 
18653853    1 MEGWLKTIVW-SKMSPEVLEEpsTQTLLLSDSWLEFLNLSPFLKQKLAALLKRVMDMSNVTVIYPPIDRIMWWSYCCEPE 79 
24943128    7 LDAWLEANVW----SRRRPHAihGEHLLLPDPWLDFLSLTPILRRKLQAVINSVRRLRQQVTIYPDEDMCMSWARFCDPY 82 
51518047    6 LDLWLEEHVW----KRKQENGvkGENLLLPDPWLDFLQLSPIFQRKLAAVIACVRRLRTRTIIYPEEDMCMAWARFCDPS 81 
82503235    6 LDLWLDEHVW----KRKQEIGvkGENLLLPDLWLDFLQLSPIFQRKLAAVIACVRRLRTQATVYPEEDMCMAWARFCDPS 81 
139424508   6 LDLWLDEHVW----KRKQEIGvkGENLLLPDLWLDFLQLSPIFQRKLAAVIACVRRLRTQATVYPEEDMCMAWARFCDPS 81 
139472838   1 MDAWLQQTVFrGTLSISQGVD--DRDLLLAPKWISFLSLSSFLKQKLLSLLRQIRELRLTTTVYPPQDKLMWWSHCCDPE 78 
291345730   1 MEAWLKRHMW-PSLQQHHSHP--DRELLLSSEWLEFLDLSPFLRHKLHTLLSTVSDLRRTCTVYPPQDLIMAWSHLCSPQ 77 
9628049    81 QVKVIILGQDPYHGGQATGLAFSVSKTDPVPPSLRNIFLEVSACDSQFAVPLHGCLNNWARQGVLLLNTILTVEKGKPGS 160
10140967   78 DVKVVIIGQDPYHGGQANGQAFSVNKGFPVPPSLQNIFKEVRSCYPDFVSPGHGCLEEWGRQGVLLLNTILTVEAKKPGS 157
9631237    78 DIKVVILGQDPYHGGQGTGLAFSVSYEYPIPPSLRNIFLELQRSDPLFHVPNHGCLNSWAKQGVLLLNTVLTVEKGKAYS 157
13095623   79 DVKVVIIGQDPYHGGQATGLAFSVHIDKPVPPSLRNIYLELARTHSSFNIPKHGCLDKWTQGGVLLLNTILTVEKGKANS 158
9629613    76 NVRVVILGQDPYHGGQANGLAFSVHENFPVPPSLHNIFQELKRSVPDFQIPPSGCLDKWAEQGVLLLNCILTVDKGRPGS 155
9626002    78 DIKVVILGQDPYHGGQGTGLAFSVSYEHSIPPSLKNIFFELQRSDPLFHAPNHGCLNSWATQGVLLLNTVLTVEKGKAYS 157
18653853   80 DIKVVILGQDPYHRGQATGLAFSVAPDYSIPPSLKNIFKEIANTVPGFTAPSHGCLDCWAKRGVLLLNTILTVERGKAGS 159
24943128   83 EVRVIILGQDPYHGGQANGLAFSVAYGFPIPPSLRNVYAELERSIPEFKAPDHGCLEAWASQGVLLLNTVLTVEKSKPGS 162
51518047   82 DIKVVILGQDPYHGGQANGLAFSVAYGFPVPPSLRNIYAELHRSLPEFSPPDHGCLDAWASQGVLLLNTILTVQKGKPGS 161
82503235   82 DIKVVILGQDPYHGGQANGLAFSVAYGFPVPPSLRNIYAELHRSLPEFSPPDHGCLDAWASQGVLLLNTILTVQKGKPGS 161
139424508  82 DIKVVILGQDPYHGGQANGLAFSIAYGFPVPPSLRNIYAELHRSLPEFSPPDHGCLDAWASQGVLLLNTILTVQKGKPGS 161
139472838  79 DIKVVILGQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSHGCLDSWARQGVLLLNTVLTVEKGRAGS 158
291345730  78 EVKVVIIGQDPYHGGQANGQAFSVNRGFPVPPSLRNIYTELRNCCPDFVPPAHGCLEQWGRQGVLLLNTVLTVEAKKPGS 157
9628049   161 HSDLGWIWFTNYIISCLSNELDHCVFMLWGSKAIEKASLINTNKHLVLKSQHPSPLAARSNRPSL-WPKFLGCGHFKQAN 239
10140967  158 HSDLGWTWFTNLIISTLSNKLNNCVFMLWGSKAIAKSLMINKQRHLVLKAQHPSPLAAKNNYSSS-QCKFLGCGHFLTAN 236
9631237   158 HSELGWQWFTDYIISSLSEKLSSCVFMLWGTKAIEKSVLIDPSKHLVLKAQHPSPLAAVGQRVKT-WPKFIGCDHFRQAN 236
13095623  159 HSDLGWVWFTNYIITSLSTNLKNCVFMLWGSKAISKAGLINNQQHLILKAQHPSPLAARGTRPSL-WPPFSGCDHFRLAN 237
9629613   156 HHKLGWGWFTDYVISTISEKNDKCVFMLWGNKAIEKEVLINGSKHLVLKAQHPSPLASLGGYSSK-QAPFLGCNHFSIAN 234
9626002   158 HSDLGWQWFTNYIISSVSEKLSNCVFMLWGTKAIEKSILIDSSKHLVLKAQHPSPLAAASQRVGT-WPKFIGCDHFNQAN 236
18653853  160 HANLGWDWFTSYIISCLSAKLQRCVFMLWGRKAIDKATLINGQRHLVLKARHPSPLATAHAATGSpWPQFLGCNHFKLAN 239
24943128  163 HSDIGWTWFTDHVITLLSNNLKACVFMLWGSRAGDKASIIDTRKHLVLSSQHPSPLAQNSTRRGT-QQKFIGNNHFVEAN 241
51518047  162 HADIGWAWFTDHVISLLSERLKACVFMLWGAKAGDKASLINSKKHLVLTSQHPSPLAQNSTRKSA-QQKFVGNNHFVLAN 240
82503235  162 HADIGWAWFTDHVISLLSERLKACVFMLWGAKAGDKASLINSKKHLVLTSQHPSPLAQNSTRKSA-QQKFLGNNHFVLAN 240
139424508 162 HADIGWAWFTDHVISLLSERLKACVFMLWGAKAGDKASLINSKKHLVLTSQHPSPLAQNSTRKSA-QQKFLGNNHFVLAN 240
139472838 159 HEGLGWDWFTSFIISSISSKLEHCVFLLWGRKAIDRTPLINAQKHLVLTAQHPSPLASLGGRHSR-WPRFQGCNHFNLAN 237
291345730 158 HNDLGWAWFTNLIISSISEKLNHCVFLLWGSKAISKGLMINKQKHLVLKAQHPSPLAAKNSYSSQ--SKFIGCGHFAAAN 235
9628049   240 EYLELHGKCPVDWNLD 255
10140967  237 KYLTQHNKVPIDWTLE 252
9631237   237 KYLEEHQKKTIFWSIS 252
13095623  238 KYLTEHDKEPIDWSVE 253
9629613   235 TYLTQHNKPSISWNL- 249
9626002   237 KYLEEHKKKPISWALL 252
18653853  240 DYLVQNRRGAVDWNIN 255
24943128  242 TFLRQKGLGEIDWRL- 256
51518047  241 NFLREKGLGEIDWRL- 255
82503235  241 NFLREKGLGEIDWRL- 255
139424508 241 NFLREKGLGEIDWRL- 255
139472838 238 DYLTRHRRETVDWGLL 253
291345730 236 KYLAQHGKVPVDWTLD 251
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap