Conserved Protein Domain Family
PHA03344

?
PHA03344: PHA03344 
US22 family homolog; Provisional
Statistics
?
PSSM-Id: 165588
View PSSM: PHA03344
Aligned: 2 rows
Threshold Bit Score: 1156.71
Threshold Setting Gi: 61660248
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9845432    1 MWSLRGALRRDVRFLGREhhemptevwQDPTALEPGTFDEDFGCVdDDLDEKHIPLSRSPVYPPDDSLIKGV-LGLSMSE 79 
61660248   1 MWSLRGAQRRDLRFDGQD---------DEWCLAYEDCMDQKFGEY-GGVDERSLPPIRSPVYPPRSFINDQFsFGLPLDS 70 
9845432   80 EGRERGtrsgpltGHDNMAALNFPDDEIAQTVSVRESREASGHRRHGS-SDSDLGSDSGRSDNEIEI---VQGHSWKSTA 155
61660248  71 TDRTAG-------GRESCGAMAESDLFIDRAALDGTGRSDAGSRDSESdSDFDMESDSDLSDDGDAAgayVYGSPWKTSA 143
9845432  156 LTVSKEIVEEHEKKNLSRRFFATVLRDFRTLYVALS-NPNEIPERIRQLSGRALTLRFPEHWYLLPQPMNEIRVLFGVDL 234
61660248 144 VTVSRKAVEKYEKKKLAQRLYSLTMRDFKSFHLALSfPPGQIAAAVVHYLGKPLVLRYPENWYLIPQRRSEIRVLRGVDL 223
9845432  235 RAYICCDVAVArdvELIPLGACAARSPDLHYRETPCAILMDTEGRFFLYDAETEGLFLAAENLVELAHKGLSACEPAYRD 314
61660248 224 SKYLCCGDTAG---ELTPLGVCAARSPDLHFRETPCALVMDERGRFFLYDAESDGLYYAARNIDQLARRGLSLCEPVYRD 300
9845432  315 GGATISLPRPRTAVKKILSACVIGLESVNAAVTSVRGTAIVLCDRASGSERILQIFDASELRRKPPFSELDDESCGAMMD 394
61660248 301 GGAVVSMPKPKTLVRKIVSAAVVGLENVAATATAFRGSTIALRDPVSGRRETFQVFGASDLKRKPPFSRMDDTTYTLVRE 380
9845432  395 YVEFRLAEEWVVLGGIGTYDNsGGFVFMVDIVVLLGVTGAVYGFGVEENDVYRLADDLSTLLRR----GISPEPNRFDRD 470
61660248 381 YITFRLAEAWTVIGAVGEYRD-DGFVFEVSTVVLVGARGTVYGFCLLSNDVFRIAEDISVFFKRggvsGGAAVPNRFDRG 459
9845432  471 ALGELRLERRALCPHEREgtrgDREPVV-----RQVARRDLRGWLRWQLRTGPDTDRCVQFAHLEEAKRQFRHPVSSLPV 545
61660248 460 ARGELRLERPPLCPHRDE----DRPPIAtslasQEIARRDLEDWYRWRLGARSRLQDGVALSNVSEAKRQLTHPAKGIPV 535
9845432  546 CVVTGESYQPKNESEQGYGVLAEGRRNFRCPRTRPDPTDeerRRQRELYQRMMCPPGPFVNQPEETYTGVIAERAARLAA 625
61660248 536 SIVTAESYHPRGDPEEAFESLSGQTRPYRYPRVCDASLS---CSDRDFYRRYVRAMDMFDGGKEKSEREIMFIRAERVGS 612
9845432  626 LQKSGTSLRLPAISRA--ATRVSRRGSPMSDR 655
61660248 613 LQKTGTPLKLPPLVRAtqAGSTSNNMETGSDR 644
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap