Conserved Protein Domain Family
PHA03343

?
PHA03343: PHA03343 
US22 family homolog; Provisional
Statistics
?
PSSM-Id: 165587
View PSSM: PHA03343
Aligned: 2 rows
Threshold Bit Score: 926.358
Threshold Setting Gi: 61660164
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
61660164   9 CPSCRRRAMARELGYTLAVTARWRRNITSVpAPFSMYPERLADARFRPQPRIIRTLDTRSEARGRAVVRFSAPRGRdwsp 88 
9845334    1 MATDYQLFVAREIGYTLAVTARWRRSGPGL-AAVGVRGICWCDVCFRPGRRVLGTTFVRGRPHAIVAVGFVGTRRH---- 75 
61660164  89 sddltalidkltpRERSFRKKGRGGETAAAAAAAAAAEKSREEEEIYENVEP--------------TVKGAAAAATASTS 154
9845334   76 -------------RRRPYWYRRPSSSTSGGCRGGGEAGTGEEVFEAGDKIRPpavrgsvspirgheTVESRPAGETSATS 142
61660164 155 AAACSLDDGRSSN--KDKRKSIISACgvaatlkksrvrrrsstrndifdndehhttsnkrkstdrltftldrhsligAPP 232
9845334  143 SRVGDGGDGGGEDggEDGGSGLGGDC---------------------------------------------------SPS 171
61660164 233 TLPDPVQLSKDFVEKLAARLSQVDSKMILCTDETLYIHELIAARDIRRLNCLIYRFHLHHVLLTWPPGWVFTVIDATRSP 312
9845334  172 VFPDLFELRDRVYRKVDLKLAAVEADMILCSDEVMFIHELAAAGQRARLRDLIRRFHGSCVLLAWPTGWVFTVVDPIRSP 251
61660164 313 RLQKASAAVVRDGHVCCEQNLIAIGVVHDLGREPSEAEYPVILVNLDGFVYMYDDGGVVPVLHLLTKCGFSDFCRRGLRE 392
9845334  252 RLQKVGGAVVRDGHVCCDVNITPIGVVHDVGSEHTESEFPVILLGDDGFVYLYDDGGVGPVLYLLTKNGFAEFCRRGLRE 331
61660164 393 RCGIGLDAGSTPIDYTEDPLKSILESRSSIDDLVVSRDRLLGAETAIFHSDSMWTLLTVSNLCDTGYDSFDYECWKHETG 472
9845334  332 RAVTDRDVTSTPVDYGEEPFKSLLECRHSLDELVGARDRLLGTEAAVFHTDNVWTFLRISRLDDLGYGQEEFERWTVQSG 411
61660164 473 QCRLEPVFMVKACVSGVWVNAPILVSDGGTVYYVDPGHGNIKFLAADLFTFLVLGVMRFRNSNCFLPNTFPQRRLEDPRP 552
9845334  412 HLRLEPMFTVKAYVDGVWVDSPVLISEAGTLFYVDRVNSRIRFLASDLYTFLVLGLVRYRSNSFYLRGAFPASRGEANRR 491
61660164 553 GQPI------------------------RPVFCPLGQRC-RRKRRVSIISRFWHWLWGTWGYVTVCCRH 596
9845334  492 KRDLtrqrnqtrahagarrggpsgavaeKTAYCPRGPRClRGGARRTWTGRAWRWLCGKWGWMVGCCRG 560
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap