Conserved Protein Domain Family
PHA03342

?
PHA03342: PHA03342 
US22 family homolog; Provisional
Statistics
?
PSSM-Id: 165586
View PSSM: PHA03342
Aligned: 2 rows
Threshold Bit Score: 952.905
Threshold Setting Gi: 9845434
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
61660250   1 MERPVTANAISAYKRVIDAFSRLVATGGDQNARRRAIERLDGKVIPLGFPQDWYVVCGSGKSCWSVLTDRANALLCCEEA 80 
9845434    1 MERPVSDNAAAGYVSVLETFSRLLVDSETADERAEAAREFDGSMIWLGFPDDWFLAGGAGKTCWEAYTRRANQLVCCEEI 80 
61660250  81 LIPLGLCGRTSDPYDTRGLRGYGVSLVLSGEYGRVYVYTASDDTLHLVARNLEELGRFGISRRSFAYKEDMQRSVPRADL 160
9845434   81 LIPLGLCGRTNRPEDPLSLSDYGTRLMLAGTQGRIYVYCSRSDVLYLVARDIEEFARFGLTRRAFTYISGSDAILSPTDV 160
61660250 161 VRLRYIASCDVPRGYPGMELLVVFSDPNADAATSVGYTRFVDGKFVRLTTPGYGTSALFLAKDPGELRGIWPFRGMCDPE 240
9845434  161 ECLNWTATEEVHDTASGREVLVVFAHPEKNDIVHVGYTRALGHGFVELVTPGYGPSALFLAKSPIELRNMWPFRGLNNNE 240
61660250 241 FKRCWNAVSDALHCSWSLIGVLGYRPGGLPDAEFRADHVIVADKFGAVYSLLVYSRAGLTRRVADSVAEFFQMGMLKRVF 320
9845434  241 FLSCWKAVSGKLRCAWCLLGVLGYRAPNAQGSEFRAEHVLIVDRFGVVYVLLLYSGFGLVRRVADNVSVLFRIGMVKRLH 320
61660250 321 sSSFEFRQRERRKERLESMPRCPHWPEQKFKYIEENCRdRFDSPTDDedyvpadcMAEHYAWLVQSTVKVHSCrPWDLDD 400
9845434  321 -SGFEFHAKTRRREKLEGASRCPHRIADRLELAREHYK-FFCEPTRD--------VIGYCSWLAQATDRTHTM-PWDLRD 389
61660250 401 PNVAPRALVTNADTGDPMKTYWDRLESAIAKVKlTAAATASDVESSGGRYGEG----PYVYKLSPVPPTYFALTCHETES 476
9845434  390 PNVAARFLKTEAENKNPMTEYEENLTLAIMHVK-AVTTTAAERRRGGSSAGKGlarvPCVYRLSFVPAHYILKADREVTD 468
61660250 477 MTMeeVYACRRRQFFCDTIVPFYRARPGPSE 507
9845434  469 QEI--VNARRQYQLYTELIVPAHGRRPYPGQ 497
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap