Conserved Protein Domain Family
PHA03338

?
PHA03338: PHA03338 
US22 family homolog; Provisional
Statistics
?
PSSM-Id: 165582
View PSSM: PHA03338
Aligned: 2 rows
Threshold Bit Score: 541.454
Threshold Setting Gi: 9845312
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9845312    3 PDDPSSACPALGLLGSPSGDEAEAddtavrsvsPSAALLCDFADEVARGTDAVRALIARHAGRLVPLPWPEGAGVLVDPS 82 
61660142   1 MDSTGKIGSRFDAACEPLVDDAEA---------TVSDVLYELAHAAGRGSLELREKLFLFAGGNLRMAWPAGAVITFVPD 71 
9845312   83 VAGWEVRPGVRNRLLQHCCCDVLVYVVGRGAGLPAGFELDVLMDVFGRYYAYRGGADDALYLLSTSAEDFAAVGYRFLYP 162
61660142  72 IQGWEPQSGRRNRVLRYFCCDVFVYPIGYASGLKVADDTLVLVDVFGRFYCYRGPPDDAIYYLAASPEQFSVIGFRYFYP 151
9845312  163 LHCRAGLGEVGIVLGRLWLLVRQGADADAVARFVVRGHGESVGVARRLPGVREVLRLCSLGCLRWSaRRDAHARgGGGLL 242
61660142 152 IHCTAGPIEIGLLLSRLWMMIRRGADADAVCRFVVRAHGETVVVARRLVGRREVLRVCSLGCSRWR-KRDSSGR-LHGYA 229
9845312  243 RAPVPDGDDAVVPLGRVRRGCWPAFGTPVFVGVPTGRVFAGDVCDGSYVLVADSLPGFSGIGVSRFFENRRFARRDlgap 322
61660142 230 PCPPPLGEYSTVPLGRVKKGLPQDPGIAVFVGLPSGRVYARQAGDSSYYLIADSIPGFVGIGATRYFENRRFGLIS---- 305
9845312  323 pedeeeRRRSGR--ERRPPCLADL 344
61660142 306 ------ERDSGRncERPPPRLSEF 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap