Conserved Protein Domain Family
PHA03330

?
PHA03330: PHA03330 
putative primase; Provisional
Statistics
?
PSSM-Id: 165574
View PSSM: PHA03330
Aligned: 2 rows
Threshold Bit Score: 1274.29
Threshold Setting Gi: 109638626
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109638477   1 MESAASHNAEHTVEPAAVVCGadmrlvylgrilipNEVGDVYGVYEAPVRIQKIGQAIWLSGCTTAQVGLPLIPKNHFTw 80 
109638626   1 MIWAVSKDLCLVYAPAAFPIG--------------RAGEEVYVLLHTHPKMKRLGFVTWLKAAKKLKEYEKITQNVHFT- 65 
109638477  81 wPSEPHNRAALYTYGALRDIATQ---TRLTVEGFVSEVFVSRVKVlCPTYERTKEKIRDTLGKACENALHPAFHYSVVRR 157
109638626  66 -SEEFLDPSAMEAALCLQDFALQlgkSQASLRDYVTTLYVEHYQT-ALSLRTYSIPANAIIKRAIADEIDVCFHSTMVRE 143
109638477 158 VLHGAHYEDAVEAERAQAGVSMQ----------SPFGWRLTPPLFHDPLRSIHELMAGDAARPYVTPVPpcASSSGVRAD 227
109638626 144 HLGGKSYEECVEFVRRFAGPKCSilrnvqkqklAGYDSRTISERLHSLLLSRKREQEAAAIKEMDDELP--LDEINAMEE 221
109638477 228 AALTVFREIQRVNAGRLQY----RRGVCAAAGFYhipmvLFKAYERKYKH---TSCFDALVQYVGGERlQEDKRQFLRLP 300
109638626 222 SPLIHTRHVSDMIDAVWSFpnlaRPNNLPSIGFY-----VFPCFDKEVTNkfgKSIFSALVDYCTGNG-SVPERTHLKLP 295
109638477 301 AREEWGTSPPALLTCDDVPRSYIICDPDSLDREWSLRTAQGAQCCWNEVCVPGRVVTNLLLDIDLraPGAPPTPEQRADI 380
109638626 296 DPTEWYDTAPILLSSDAEPRQYMICDPQHMHERWEAETAEGRQTCWHEVFLPGRSITNIPMDIDI--ASFEPHWEDDKLY 373
109638477 381 VESLAQLPAHIVR----SVTGLPDPGSAGCVVVYHRPC---EGKLSFRVLWKLPLQLCRWDTGGRLVREarrlslaqrlp 453
109638626 374 GAVLDSLLCCVVKmlelNFEVKVNEGEVGAFYFFQRQCapeKQKVSMRILWQLPLQLCAMDISISLVEK----------- 442
109638477 454 hLVQQAALVAADLG-EGVSS---LSHWYRRTFGVDVEDPCSWHcvrgEIPPPDRPFEVRTINGAHVLKAEAGASVHLRLM 529
109638626 443 -MMAEVALHATEHKmEGLTQyclVDHKGRRYYTDVLSDEWCYP----DLNLEDCPLWLQGKRGGDKYPYDPKCHLSLNLK 517
109638477 530 RAARRADLYV--SAVDVGPYSHRKSVRLPLCDKPHNgGRFALHVVRSACFPGELQGF---GRVPSDGLAAWTADDLRIFL 604
109638626 518 RAAHVLDEMAvhCCLDVQPYGARKSLRMPLCDKPKE-GRFEYKRTYNQNMVDGTEFWsnpSQSPVACLSCVPVDSRRSFL 596
109638477 605 PRL--GNLEQLEKEEEGRQEDVQKQSVTLTEVNAEIALDRLRCSAGCNA---YSRGNGILYTPQSRY--CGLHKREHSDR 677
109638626 597 SSLssGMVEQYFQSIRGAQKPAAHRMPALDTAVINKVIGRLAAFYKVPQvyfSASNENTIYPRSADYviCPLHGRKHKTK 676
109638477 678 HKHyYTAQSPDVLFLRCFVPAAQgeaQWLKLTWDPIRNTYfprdwpTNISA 728
109638626 677 ALR-FAVKNVDTLLVLCWKPAVR---KFLYLRWSDHFGAY------SYYTP 717
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap