Conserved Protein Domain Family
PHA03324

?
PHA03324: PHA03324 
nuclear egress membrane protein UL34; Provisional
Statistics
?
PSSM-Id: 165570
View PSSM: PHA03324
Aligned: 2 rows
Threshold Bit Score: 501.915
Threshold Setting Gi: 155041954
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38638224    1 MRSDKYSQLVSVVNAGLGACGTSATLVYIRNNARVAPTGDIITLPARLDGPPIPAEYILEAMTSLLSIRTAWLRIQNTGQ 80 
155041954   8 NQGDKYCQLVRFVNAGLSLAGTTASLVYTRDNARLAPTGDIFTLLAKLDGPPIPAEYILEAMNSFLNIGESWLRIQNTGQ 87 
38638224   81 AVIVAGCSTQNFHHGDVTWEPPASTVTLTTAKSLWVSASAVREMKVIQRIRTAPLAAMMFMCFYRGGKNEVTVRFAFYKS 160
155041954  88 AVIVAGCFTKTANCKDQIWPASSPTISLAAAKSLWVSSSSVKEMKRLQKLKNAPLATMMYISFYRGSRTDITIRFAFYRS 167
38638224  161 DSEPNLLKISKCVYEAIDAEATRnlpkprgfDTPPCAVLAQRMRPLGAAEGGDRETSAQTHSPAAQAQHVMQHATATKSw 240
155041954 168 DSEPNLIKITRRVQEAIDSAEQE--------DSYKTAALLKKTLMETTSEMPTSHSVAESKPSRSIFERVTTYFRIHVK- 238
38638224  241 gALGRTLKHKKNLGWILFTCALSLAAAFVTAYIK 274
155041954 239 -CLNPRSFSLQPLMWVLMGVAWPAFLTLLIFYLI 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap