Conserved Protein Domain Family
PHA03312

?
PHA03312: PHA03312 
helicase-primase subunit BBLF2/3; Provisional
Statistics
?
PSSM-Id: 177582
View PSSM: PHA03312
Aligned: 2 rows
Threshold Bit Score: 1516.54
Threshold Setting Gi: 82503240
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82503240    1 MMETPAESVRARVSSVTFYNVTQTAGRWWAIWVVGIVPIKREDVETLIVVQACQPPLGGSLEPPVVNAPSTTELNFLRWE 80 
139424513   1 MMETPAESVRARVSSVTFYNVTQTAGRWWAIWVVGIVPIKREDVETLIVVQACQPPLGGSLEPPVVNAPSTTELNFLRWE 80 
82503240   81 RELRRSGGLIAMLADAAEKDLFDLSFRTRDRRLLSAARVEDEQGLIFQPLFPAQVVCQSCSGDDGRDQQPPPVDGFGSEM 160
139424513  81 RELRRSGGLIAMLADAAEKDLFDLSFRTRDRRLLSAARVEDEQGLIFQPLFPAQVVCQSCSGDDGRDQQPPPVDGFGSEM 160
82503240  161 EGEQTCPHAQRHSESPGQLDVYIRTPRGDVFTYSTETPDDPSPVPFRDILRPVTYEVDLVSSDGATGRGGDARRHRVSLK 240
139424513 161 EGEQTCPHAQRHSESPGQLDVYIRTPRGDVFTYSTETPDDPSPVPFRDILRPVTYEVDLVSSDGATGRGGDARRHRVSLK 240
82503240  241 ILEPAGGFESWLVNSWSMAGGGLYAFLRSIYASCYANHRGTKPIFYLLDPELCPGGSDFQPYVPGFPFLPIHYVGRARPA 320
139424513 241 ILEPAGGFESWLVNSWSMAGGGLYAFLRSIYASCYANHRGTKPIFYLLDPELCPGGSDFQPYVPGFPFLPIHYVGRARPA 320
82503240  321 FWHRAPHSEGLLLLDLNLGVSGTPLADALLGLDARSGQRRGSLLLQQIWPPTRKEINPRHVCTREGGEGGGEDETTVVGR 400
139424513 321 FWHRAPHSEGLLLLDLNLGVSGTPLADALLGLDARSGQRRGSLLLQQIWPPTRKEINPRHVCTREGGEGGGEDETTVVGR 400
82503240  401 AEATAILEADATWWLYELARCHLSARGAPVGTPDGGGQARDAQTWLRALHRYGTSDTRRALGGLYTAVTRVLLHAAADLG 480
139424513 401 AEATAILEADATWWLYELARCHLSARGAPVGTPDGGGQARDAQTWLRALHRYGTSDTRRALGGLYTAVTRVLLHAAADLG 480
82503240  481 LTWAYADEFILGFVAPTSAHPSEEPLAQAFLQGVKDSEDASRLDRDVMGGEATVARRHIRVKARRGPGCLLMAIFQGDLY 560
139424513 481 LTWAYADEFILGFVAPTSAHPSEEPLAQAFLQGVKDSEDASRLDRDVMGGEATVARRHIRVKARRGPGCLLMAIFQGDLY 560
82503240  561 VGGCREHSGPFLVWHEAFSWTLDQLAARPEADKAPPSHDHLLTLVRDLTRRLAPGRRRNRFWALPRAWLQRLRRAGLRLS 640
139424513 561 VGGCREHSGPFLVWHEAFSWTLDQLAARPEADKAPPSHDHLLTLVRDLTRRLAPGRRRNRFWALPRAWLQRLRRAGLRLS 640
82503240  641 GSHVCLLDKDGARPAPCQTATEHGLSPTAYFREIMAFLLDVISALHPGYTIPMEITRETDLLMTVLSLF 709
139424513 641 GSHVCLLDKDGARPAPCQTATEHGLSPTAYFREIMAFLLDVISALHPGYTIPMEITRETDLLMTVLSLF 709
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap