Conserved Protein Domain Family
PHA03309

?
PHA03309: PHA03309 
transcriptional regulator ICP4; Provisional
Statistics
?
PSSM-Id: 165564
View PSSM: PHA03309
Aligned: 2 rows
Threshold Bit Score: 3532.83
Threshold Setting Gi: 38638258
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38638258    1 MFWHQPRQQQLRQLQRAASGAGKHQRRSPPQTLGDDGDAAAQVPPSPTGALLAFLNQHASEEGGAAAASADGRVSVSPGF 80  
38638269    1 MFWHQPRQQQLRQLQRAASGAGKHQRRSPPQTLGDDGDAAAQVPPSPTGALLAFLNQHASEEGGAAAASADGRVSVSPGF 80  
38638258   81 CSSILPEHSQDLFAFSDPTSASPQPVPMDASLSLFTPPVPDCGRDVGEEAEGAVAPSWRAPLPAPQWRPVHGPSWWLSSS 160 
38638269   81 CSSILPEHSQDLFAFSDPTSASPQPVPMDASLSLFTPPVPDCGRDVGEEAEGAVAPSWRAPLPAPQWRPVHGPSWWLSSS 160 
38638258  161 SPSGSSRGSVTSPQYSGEETSDAASGAPTPPPQSSGSSYVYGQALADLMAMIQEIPAPPRSVPDCRRGEPVSEDGMADRC 240 
38638269  161 SPSGSSRGSVTSPQYSGEETSDAASGAPTPPPQSSGSSYVYGQALADLMAMIQEIPAPPRSVPDCRRGEPVSEDGMADRC 240 
38638258  241 ETDASCYTTDEPMEAEPSEPAGGVSWLGERADRMRADQSPRGLGAEPHVAEAGRPSSCVGEERADVVAIAAVEERKEAAR 320 
38638269  241 ETDASCYTTDEPMEAEPSEPAGGVSWLGERADRMRADQSPRGLGAEPHVAEAGRPSSCVGEERADVVAIAAVEERKEAAR 320 
38638258  321 RSPDAERNDDEEEYESLPCAQEFFTSQELAEINARAIAESDEAEDEDAGSPAARSQSSPFPSLGPAVFVLAPTSAKSSRG 400 
38638269  321 RSPDAERNDDEEEYESLPCAQEFFTSQELAEINARAIAESDEAEDEDAGSPAARSQSSPFPSLGPAVFVLAPTSAKSSRG 400 
38638258  401 MRKKAIAVSRVVPDNDGEPDPCADGPGRDHVSSAQSAGANGALETETSVPRSATAPAGAVAACAQNTKRGYWRGAAAGHA 480 
38638269  401 MRKKAIAVSRVVPDNDGEPDPCADGPGRDHVSSAQSAGANGALETETSVPRSATAPAGAVAACAQNTKRGYWRGAAAGHA 480 
38638258  481 EEETDSDDEDVLVVDVSACAEPFESFAQRQQPRQQQHAPRNKPARQRLRAGAIVAAASGNTLTVPSEPPHPSLAPLWKML 560 
38638269  481 EEETDSDDEDVLVVDVSACAEPFESFAQRQQPRQQQHAPRNKPARQRLRAGAIVAAASGNTLTVPSEPPHPSLAPLWKML 560 
38638258  561 NLWLSEEWPAQGGGQDEGEAAVSASLLAPGSLPELPDMCPRVAVGIISHALAVDLSAPGGRITVDEALLPKPPAADYVYY 640 
38638269  561 NLWLSEEWPAQGGGQDEGEAAVSASLLAPGSLPELPDMCPRVAVGIISHALAVDLSAPGGRITVDEALLPKPPAADYVYY 640 
38638258  641 GKTGYRPSMAAHPDVRRAAEEFSASDAAARVYVEEFGMAVEQHERLVAEFMLQPLSRVSHSYGGSRLNKTEKNLCKICLP 720 
38638269  641 GKTGYRPSMAAHPDVRRAAEEFSASDAAARVYVEEFGMAVEQHERLVAEFMLQPLSRVSHSYGGSRLNKTEKNLCKICLP 720 
38638258  721 PDGGDDRDGGGKSRGGRGGGSKDASRTAMATGVPHIVHAMRDGRAALALPHLMDVIRVCRRYDASQKTYLLSCLRLAFAP 800 
38638269  721 PDGGDDRDGGGKSRGGRGGGSKDASRTAMATGVPHIVHAMRDGRAALALPHLMDVIRVCRRYDASQKTYLLSCLRLAFAP 800 
38638258  801 LVFPGASPPVGADDSPWPTSPIRECAAALREGFRALNDIRAEQDPPADERSRELALPLDRAITAARRVAATAAGLLNAVG 880 
38638269  801 LVFPGASPPVGADDSPWPTSPIRECAAALREGFRALNDIRAEQDPPADERSRELALPLDRAITAARRVAATAAGLLNAVG 880 
38638258  881 ASVVHDGRVGLPAFFLRGVTERREDLFSAARRCPRALYSWERSMRATTAALWGHLASRGPIAAPVADLEELSQALSAVLS 960 
38638269  881 ASVVHDGRVGLPAFFLRGVTERREDLFSAARRCPRALYSWERSMRATTAALWGHLASRGPIAAPVADLEELSQALSAVLS 960 
38638258  961 VTSVPDGGDVRYAFAEADEGWRALAVMLGGGAVRTSSGESGDAETDAAYALLAPGKQSSAGVNHPRGRPGRATASSPRTP 1040
38638269  961 VTSVPDGGDVRYAFAEADEGWRALAVMLGGGAVRTSSGESGDAETDAAYALLAPGKQSSAGVNHPRGRPGRATASSPRTP 1040
38638258 1041 ASRPPHGSAAAPPSGRDSPPGALNVPEAAEEELRLAAARDTTGDLLSDEAGTDDDGDAPVVISYVGPSSPPGVEDPSPDG 1120
38638269 1041 ASRPPHGSAAAPPSGRDSPPGALNVPEAAEEELRLAAARDTTGDLLSDEAGTDDDGDAPVVISYVGPSSPPGVEDPSPDG 1120
38638258 1121 LAALRPLPEGYVPRPGDVLRGDPGADENDDDARAPCRVGDASPPRQLPSSSSFASSSLASAVPGDPYLPRSVAEPTLCRL 1200
38638269 1121 LAALRPLPEGYVPRPGDVLRGDPGADENDDDARAPCRVGDASPPRQLPSSSSFASSSLASAVPGDPYLPRSVAEPTLCRL 1200
38638258 1201 AEHLQSDDGWTRAFANDPVGLAEFARRSTPGRRLGGQRRLDQLLSWTRRHSPRRRYSLIVLVSEKRPGDFRERAYAAAAL 1280
38638269 1201 AEHLQSDDGWTRAFANDPVGLAEFARRSTPGRRLGGQRRLDQLLSWTRRHSPRRRYSLIVLVSEKRPGDFRERAYAAAAL 1280
38638258 1281 AGRACVPGSACDPETWRDAEDHPSPSADAQSPLRSRPSRDCFPPRIAQPEASDDDDVGEGGTALLSAGDIGFAGAVESML 1360
38638269 1281 AGRACVPGSACDPETWRDAEDHPSPSADAQSPLRSRPSRDCFPPRIAQPEASDDDDVGEGGTALLSAGDIGFAGAVESML 1360
38638258 1361 RRALSRQGQACAVVDARDDKDVLSAAAPRFPRGKPGLIYLRVAPPSEACVANLPSLGPSASPHRGVGGKHRDKRPCLAEG 1440
38638269 1361 RRALSRQGQACAVVDARDDKDVLSAAAPRFPRGKPGLIYLRVAPPSEACVANLPSLGPSASPHRGVGGKHRDKRPCLAEG 1440
38638258 1441 TPSAPSCRDAARATAPLSGDPVAHRLLMHRPAKPLVGEEACAALLGGKAGRRGQDVPLPFLTAATLRKVARVARELDPGW 1520
38638269 1441 TPSAPSCRDAARATAPLSGDPVAHRLLMHRPAKPLVGEEACAALLGGKAGRRGQDVPLPFLTAATLRKVARVARELDPGW 1520
38638258 1521 GHGDLGCESAVVFPPAAPPGPELADRHADRRRSTKGPQRPGGKRPRSSSSSSSASHDRSPSSSSRRRDGRPSSRRRPSRR 1600
38638269 1521 GHGDLGCESAVVFPPAAPPGPELADRHADRRRSTKGPQRPGGKRPRSSSSSSSASHDRSPSSSSRRRDGRPSSRRRPSRR 1600
38638258 1601 MSARPPSRPPAAVILRASWRYAEEVAREMLDAAASRFDEADGEDPLPPAACGGKPIAPETLVALCEQRGRGPTSLPRAPT 1680
38638269 1601 MSARPPSRPPAAVILRASWRYAEEVAREMLDAAASRFDEADGEDPLPPAACGGKPIAPETLVALCEQRGRGPTSLPRAPT 1680
38638258 1681 PRSGEALAAPRRSGAKDPRQGQYCPSARRSEAPHSPSPRDVALRLLERQQELNRQLLLELRRGSCEISPSPRRRDAEGRR 1760
38638269 1681 PRSGEALAAPRRSGAKDPRQGQYCPSARRSEAPHSPSPRDVALRLLERQQELNRQLLLELRRGSCEISPSPRRRDAEGRR 1760
38638258 1761 FGCRQDDDDGYDYEGGRESPERVLGRRQSRRDSVPVRRRSGAANCGGRWMISAGRSSSSSSSSSSSSSSSPSSRPSRSAT 1840
38638269 1761 FGCRQDDDDGYDYEGGRESPERVLGRRQSRRDSVPVRRRSGAANCGGRWMISAGRSSSSSSSSSSSSSSSPSSRPSRSAT 1840
38638258 1841 PSLSPSPSPPRRAPVDRSRSGRRRERDRPSANPFRWAPRQRSRADHSPDGTAPGDAPLNLEDGPGRGRPIWTPSSATTLP 1920
38638269 1841 PSLSPSPSPPRRAPVDRSRSGRRRERDRPSANPFRWAPRQRSRADHSPDGTAPGDAPLNLEDGPGRGRPIWTPSSATTLP 1920
38638258 1921 SRSGPEDSVDETETEDSAPPARLAPSPLETSRAEDSEDSEYPEYSNPRLGKSPPALKSREARRPSSKQPRRPSSGKNGHT 2000
38638269 1921 SRSGPEDSVDETETEDSAPPARLAPSPLETSRAEDSEDSEYPEYSNPRLGKSPPALKSREARRPSSKQPRRPSSGKNGHT 2000
38638258 2001 DVSAASAFFLGRPAPGSCGRRPLGARVRGGTER 2033
38638269 2001 DVSAASAFFLGRPAPGSCGRRPLGARVRGGTER 2033
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap