Conserved Protein Domain Family
PHA03308

?
PHA03308: PHA03308 
transcriptional regulator ICP4; Provisional
Statistics
?
PSSM-Id: 165563
View PSSM: PHA03308
Aligned: 2 rows
Threshold Bit Score: 2920.7
Threshold Setting Gi: 57790993
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
57790993    1 MSSDSSTPSNLAAPIVDESGFSTGPPSDLFTFLRADKSGRYDSLGSPIPNPPNAPTCETTTDSFSYSTPPLFSSEDELFH 80  
57791007    1 MSSDSSTPSNLAAPIVDESGFSTGPPSDLFTFLRADKSGRYDSLGSPIPNPPNAPTCETTTDSFSYSTPPLFSSEDELFH 80  
57790993   81 SVIAENAAQDAAQDVDGREMSLRDLIAMLNDMDPENINSIEPCPNATSDVVALDINVDTDQPGVYTVIDSLAHPCETPME 160 
57791007   81 SVIAENAAQDAAQDVDGREMSLRDLIAMLNDMDPENINSIEPCPNATSDVVALDINVDTDQPGVYTVIDSLAHPCETPME 160 
57790993  161 QQHVECPCPLPAVEKTTAVRRQEVVRKSERVARSRSRRPWRDLWSNRRPVPSPQRTSKDRLPKRGKREFSKKMGPSHLTS 240 
57791007  161 QQHVECPCPLPAVEKTTAVRRQEVVRKSERVARSRSRRPWRDLWSNRRPVPSPQRTSKDRLPKRGKREFSKKMGPSHLTS 240 
57790993  241 SSSSSSSSFSLSGRRGRLARRLESAGSEKSTESPDRDSAQLVLPGECPDVALEPLWRVLREWVETDGTDGSVQSVTAPTE 320 
57791007  241 SSSSSSSSFSLSGRRGRLARRLESAGSEKSTESPDRDSAQLVLPGECPDVALEPLWRVLREWVETDGTDGSVQSVTAPTE 320 
57790993  321 LPDLGRGITLNVLSRALAVDLHSSEARVFVPEAIIPSPPSRGQVYHGSGYRQSLVDDPQVREAAAEFHANPKSASVYLEE 400 
57791007  321 LPDLGRGITLNVLSRALAVDLHSSEARVFVPEAIIPSPPSRGQVYHGSGYRQSLVDDPQVREAAAEFHANPKSASVYLEE 400 
57790993  401 YGMPVEQLERLVEEFMVHPLSRVSYGYGGPKLSPRDKRLCELCALRGPGSSEGGLSRSAVPTCLPHVAHAMRDGRVSLAL 480 
57791007  401 YGMPVEQLERLVEEFMVHPLSRVSYGYGGPKLSPRDKRLCELCALRGPGSSEGGLSRSAVPTCLPHVAHAMRDGRVSLAL 480 
57790993  481 PHLTELVRVCRRYDHPQKTYLLAALRRAFVPFVFPGAAVDPTAASASGDHPVLVGARRIARATRELEAAAKEPPAATPEK 560 
57791007  481 PHLTELVRVCRRYDHPQKTYLLAALRRAFVPFVFPGAAVDPTAASASGDHPVLVGARRIARATRELEAAAKEPPAATPEK 560 
57790993  561 LSSSALLRHTRTCIVAAADLMAALTAIDCPPVTINPAKRRPDLYQALSRAPKTVFTWERAMPYCAASLWSRLVIGSLPLP 640 
57791007  561 LSSSALLRHTRTCIVAAADLMAALTAIDCPPVTINPAKRRPDLYQALSRAPKTVFTWERAMPYCAASLWSRLVIGSLPLP 640 
57790993  641 STDDVTLLVEAMEAAVGVLGCSDEGDVRPSIAYAASGWRMIATMLGDDSAPGSEHVTDDCPADDDTHHHDRRKRRGGRRT 720 
57791007  641 STDDVTLLVEAMEAAVGVLGCSDEGDVRPSIAYAASGWRMIATMLGDDSAPGSEHVTDDCPADDDTHHHDRRKRRGGRRT 720 
57790993  721 TCRYDLPPGTPDRAAHLLLYGSPGGGDGAEPSAAQESPANPWPRAPPCDEQEPLSVSPYGPEPDRPPDDDFETRKGLKRK 800 
57791007  721 TCRYDLPPGTPDRAAHLLLYGSPGGGDGAEPSAAQESPANPWPRAPPCDEQEPLSVSPYGPEPDRPPDDDFETRKGLKRK 800 
57790993  801 SSEDHADPIPEGNATKKTCGLQGLPDSLPPAVPETDRDNPLLPPCPITPEGPPCPPREEPQQPQEPQEPQSPSFHISEIG 880 
57791007  801 SSEDHADPIPEGNATKKTCGLQGLPDSLPPAVPETDRDNPLLPPCPITPEGPPCPPREEPQQPQEPQEPQSPSFHISEIG 880 
57790993  881 EALFHSTPVSPTILFAPEGFIPNQGDVYRPHGKNLGVALSAGEPYVPAHRARPALERLANYLRGLSSGPAGSYSATGPAD 960 
57791007  881 EALFHSTPVSPTILFAPEGFIPNQGDVYRPHGKNLGVALSAGEPYVPAHRARPALERLANYLRGLSSGPAGSYSATGPAD 960 
57790993  961 WLPAFARDPVALGEFCKRISPVNRGGRCVLEERLSWTLRHPADKIYDLIILVSERAPGEFLERAYAYAALCGRACMPGGA 1040
57791007  961 WLPAFARDPVALGEFCKRISPVNRGGRCVLEERLSWTLRHPADKIYDLIILVSERAPGEFLERAYAYAALCGRACMPGGA 1040
57790993 1041 CWPESWTRGEYPYIPPDEKDPGRSVAILCTTDLGYAGAVEWMLERALSTSGRACVVVDARDPGDEDSRSGPRIPTGRRGV 1120
57791007 1041 CWPESWTRGEYPYIPPDEKDPGRSVAILCTTDLGYAGAVEWMLERALSTSGRACVVVDARDPGDEDSRSGPRIPTGRRGV 1120
57790993 1121 VYARTSPPSHAYLVKLFTGPAAERLERGGLNVGHVVMDRRLTVSWPLSVGKTDNDDEGTGDREKCPPVKHPFLTHVTLRR 1200
57791007 1121 VYARTSPPSHAYLVKLFTGPAAERLERGGLNVGHVVMDRRLTVSWPLSVGKTDNDDEGTGDREKCPPVKHPFLTHVTLRR 1200
57790993 1201 LRDVARAMDAGWSHSEIGKASAVLYPYMAQPHVGAGAMPPCPDLSESSSTMHSSSSSSSSSCSSSSSSSDSSSSEEDGDE 1280
57791007 1201 LRDVARAMDAGWSHSEIGKASAVLYPYMAQPHVGAGAMPPCPDLSESSSTMHSSSSSSSSSCSSSSSSSDSSSSEEDGDE 1280
57790993 1281 KNEKEDRERAGGGKRRGRQRLPIRDRVYRGRDYRVRTPCADIVGGTSASFRAVAAWGRDTVIPALPLAASWSDPSKIPQE 1360
57791007 1281 KNEKEDRERAGGGKRRGRQRLPIRDRVYRGRDYRVRTPCADIVGGTSASFRAVAAWGRDTVIPALPLAASWSDPSKIPQE 1360
57790993 1361 VLRIISDYYPDAPGARARRNPLHVEGLALMRARNPAPLALLLGDDYSHYHTPRNRSPMCCCWSAPRGATPESLRCTGHTR 1440
57791007 1361 VLRIISDYYPDAPGARARRNPLHVEGLALMRARNPAPLALLLGDDYSHYHTPRNRSPMCCCWSAPRGATPESLRCTGHTR 1440
57790993 1441 TRRPRLSVSSGRGETRTLVPRLD 1463
57791007 1441 TRRPRLSVSSGRGETRTLVPRLD 1463
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap