Conserved Protein Domain Family
PHA03303

?
PHA03303: PHA03303 
envelope glycoprotein L; Provisional
Statistics
?
PSSM-Id: 165560
View PSSM: PHA03303
Aligned: 2 rows
Threshold Bit Score: 309.592
Threshold Setting Gi: 9625934
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625934    1 MASHKWLLQIVFLKTITIAYCLHLQDDTpLFFGAKPLSDVSLIITEPCVSSVYEAWDYAAPPVSNLSEALSGIVVKTKCP 80 
13242455   1 MEGHRFVLQMVLFFWLYKTHGLYIENDD-IFLGSKYISDVSSIITEPCISFQENLWKYSAPSVPNLKEDISGFVLKSSCP 79 
9625934   81 VPEVILWFKDKQMAYWTNPYVTLKGLAQSVGEEHKSGDIRDALLDALSGVWVDSTPSSTNIPENGCVWGADRLFQRVCQ 159
13242455  80 IPELIIWFKNKHMAYWVNPYVMLHGLVNTIYIEESEDDMRGVLVERLSTALQSRGDISTDPPDIGCVFGAQNVFQRLCL 158
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap