Conserved Protein Domain Family
PHA03299

?
PHA03299: PHA03299 
envelope glycoprotein L; Provisional
Statistics
?
PSSM-Id: 165556
View PSSM: PHA03299
Aligned: 3 rows
Threshold Bit Score: 343.404
Threshold Setting Gi: 10834869
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
149999617   3 VSMSVACILLVYVYRvFFASAEAFMNWSDRDLTYGFVRAPNVTTIVHLECIPTSKLTSMRYAEPSSDEVPSGIIIKTNCS 82 
125745052   1 MKIYRVLVHLSFVLG-MFTKTNTVLAWSKYDLVHGFMRVANISSIMRLDCLPNLLSSNAGYAALPSDDIPTGIFIKVNCS 79 
10834869    1 -----MHVSLVWVLClLFGTSGGVLKWSDVDLSRGFISVPNVSSLMLLDCAPNSILSTARFADLTTDDVPTGIFIKINCS 75 
149999617  83 LPEFILWYERVGVAAWVNPIIGTSLLLEDVLRSRLDDSVKAGIGTLLSKIAYLIPTSHLRNRGAGCINLYASHDGTCYGS 162
125745052  80 IPEFILWYEQKAMAAWINPIMGTVLMMNDVLKSGLENSVKVGLLTFLKRIAEKGPNGPLRNRGSGCINLIAPADISCYGS 159
10834869   76 VPEFILWYGSKSVAARLNPIIASALMMDDVLKSGLDDSVKAELRVFLKRISERLPWSSLRKR-HGCLNLDAPYDFSCYGS 154
149999617 163 VHFDRFERSADDDNRGSFCRNKTPRLRNGGRPRET 197
125745052 160 TRLDRFNRDFEDDSRGMPCRAKAMRRTTSGSRRAN 194
10834869  155 ARLDRFERDIEDDGRGMSCRAKSTRAKAARTNAIE 189
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap