Conserved Protein Domain Family
PHA03298

?
PHA03298: PHA03298 
envelope glycoprotein L; Provisional
Statistics
?
PSSM-Id: 165555
View PSSM: PHA03298
Aligned: 2 rows
Threshold Bit Score: 251.602
Threshold Setting Gi: 148828636
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148753576   1 MGAGAAIAVWAAALIALYSSCAAQTAPKTSSLRAANASDTIGRlidgaeqlvsmrcmtsfehEAAVTLYGPeyTPGGSMF 80 
148828636   3 MIFKMLTCFFLIASLMLCSSVDIPGIFRDPVSAAAAPCDSNSR-------------------DNGARIFGP--LPSGDYF 61 
148753576  81 EDLLTIIFKPQCSPPEAILWYKSGTAVRVNPYYLCRILVLALQGNPRGEVKFVVSRLIAEHAGGPLV--RWPTTNVLRPE 158
148828636  62 ENLTVIIYRPLCVNTEVVFYYKNGYAAKVNPYLGIRLLQDRLEATGLAAANVLARGLVDSLYKRTTInfRWPETNINHYH 141
148753576 159 KTAPGGV 165
148828636 142 PDYASSP 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap