Conserved Protein Domain Family
PHA03297

?
PHA03297: PHA03297 
envelope glycoprotein L; Provisional
Statistics
?
PSSM-Id: 165554
View PSSM: PHA03297
Aligned: 3 rows
Threshold Bit Score: 385.153
Threshold Setting Gi: 155041724
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
216905915   1 MRRFMRCWARIELIYMLAWLVTTKLVKATRLDFTWGPGEPKRILEASCGSGPIMKGQLFTSPNIKNLLNRTTGIMVKAHC 80 
155041723   1 MRRFMRCWARLELVYMLAWIVTTKLVKATRLDFTWGPGEPKRILEASCGSGPIMKGQLFTSPNIKNLLNRTTGIMVKAHC 80 
155041724   1 MGRPMFCWIKLELIYMITWLVATKLAKSNKLEFTWSSGEPKRILEASCGSGPIMKGQLFTPPNVKNLLNKTLGIMVKAHC 80 
216905915  81 NPPEAILWVDTPPKPVWVNPFAVIQGLAEDVTNGNMPQDFKEKLLFALDDSLSQSQSSPDETLGPPPLGCFTGPFFLSPP 160
155041723  81 NPPEAILWVDTPPKPVWVNPFAVVQGLAEDVTNGNMPQDFKEKLLFALDDSLSQSQSSPDEILGPPPLGCFTGPFFLSPP 160
155041724  81 TPPEAILWVDIPPKPVWVNPFAVIQGLAEDVTNGNIPQDFKEMLLLALDESLTQSQASPDEILGPPPLGCFAGPFFLSTP 160
216905915 161 KSKDIAEGLKDSCIPASYYANLQKT 185
155041723 161 KSKDIAEGLKDSCIPASYYANLQKT 185
155041724 161 ESKEIAEGVKDSCIPASYYAEIQET 185
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap