Conserved Protein Domain Family
PHA03296

?
PHA03296: PHA03296 
envelope glycoprotein H; Provisional
Statistics
?
PSSM-Id: 165553
View PSSM: PHA03296
Aligned: 2 rows
Threshold Bit Score: 1387.05
Threshold Setting Gi: 38638211
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38638211   1 MVTPRSAVPAARPLAARRLASVAWACAALLALVALQCATATKD-----IVTMHATRNSLIPKDTLTVAVVMIDSYDNRLV 75 
57790947   5 HFLALYSFLLERAWLHQQPAPMGHAREIFFLILAILLRAKGDDkakakIVFVPPTSENLAPPKEFIAIATAVENGHITQL 84 
38638211  76 FHANKNLLFGASNTSARALAEAYNLLGEVYVTYAYYRW-ARDDRPVAVGRPAPDYVLGTRLLSGPGSQKIKPPEERPSFP 154
57790947  85 CLVDRNLIFGPPGSANRNLSIALDLLGQLYVAYTYSRWgSASEATIQPRKFSNDPKLEHRLLVGYKGNALTSAKLVNFPP 164
38638211 155 LSGSLRGKSLLMPRKVIFNDPLQTLMPFVFTRYLSITLSGYWDISVNSGKNVFSLCVSSPATPPVEVIATPRSAKLRESR 234
57790947 165 NNSVHRGESIIAPIRVIYSDPLQTVFPFVFTRYISLAVTSDIDLKINIGLNVATLIIATQHSPQIEMIITPTSAKVKETS 244
38638211 235 FPQWPRYLYVSSSETSVLVNVAAGTSYKPRLYNATLAGVKAFLEVQNYGSHVAAGQLLTIKQLLKHGCNREPDEPFVVAA 314
57790947 245 LKSWPYMLKAEDQGLTVRINVAAGPNYRPNLFTAVTTAAQDFLELASFDEQISAGHFLTLQKVAIAGCPNTIDESFFVRF 324
38638211 315 ALHFGAAWHRFAALAAETYVTDAEILEFVVTTETWAKQVELCFSANapqlGAAPPASRLAILSGRGGAdegLINVPYAIL 394
57790947 325 AARFMAAWFRFLKFTIDAYVTDSEIVEFIAETQTWADQVAVCFGGA----NSVNYTTNIRFIQNVGGA---LTSIPSSIL 397
38638211 395 QVSRERYWGE-VRSVNEQLTILTAILGSVDRLGAAAYLPSADGVAPHAFAASIIDSYYHKLIRGSATDKIDRKTLSAAVR 473
57790947 398 KIMHDRPWEPmIKNHNLLLTIMNAVLITAEQDPQNAFLASIDGVTPSQLALEIIDNSYREIITQKVMTPAYRKLLAVSTY 477
38638211 474 VFLARKADSIPTARRVLTHMTVLCSEHQAQNpLVDITGTIDAASGHGEIFCLDDLFTPCAAALRFDLEPQAnrPSGNVIS 553
57790947 478 IILRAPQLSIQHGRNFLRRMTILCSVDRLAD-INEIHSQPDGSFKKGQASKIEEWFSPCAIATRFDISRSA--PWKIILT 554
38638211 554 ASAVYRTLYGS-FLYGGSELEtaallddSARVIAAAQPVGGPKAYADMFFPELARCFDWTRENSIVFYIAISDSASWILT 632
57790947 555 ASAPFRFFYTKiYLSSEGELP-------SYSAPIPPQALLTPQILATAFFPEVKKCLNWDLEHHIVFFLPVTAHSSWVMT 627
38638211 633 TRPVTGGVRYRLPDTSIRTNLYLTYFNASCSKEPFASRVEKITSGYVNlhGASIACKLCGHALLRYSLGGFEDVFVIRTA 712
57790947 628 SSPPSTGMTYRLPDTSTAAPLFVTFVNSSCNSLPQIARTAKMEDGHLN--GRAKTCIYCNHLIVQYGLRGFQDAFFIDSA 705
38638211 713 DEERQMTMGANSSIQYFRAMDPTYFNYILMDSSGSALRVLAFTHGSYAVDKNYIIGIAVGSLAGVFAVAFAARSIYKFYR 792
57790947 706 YVQSELLAGANSSIAFFKSMNPEFYNYALLGPHGTAVRILGLDRSIIVFDKAYIIGIVVGALVGLVALWSAIRAIYKFCL 785
38638211 793 GRANRYTLLTNDYD 806
57790947 786 SSATQFRRVRLPSD 799
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap