Conserved Protein Domain Family
PHA03292

?
PHA03292: PHA03292 
envelope glycoprotein I; Provisional
Statistics
?
PSSM-Id: 177577
View PSSM: PHA03292
Aligned: 5 rows
Threshold Bit Score: 437.852
Threshold Setting Gi: 296316070
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
216905926   1 MAKLAKLTSAAILLSMAICSTAIIYRGEHMSMYLNSSSEFAVYPTDQSLVLVGHLLFLDGQRLPTTNYSGLIELIHYNYS 80 
50313314    1 MAKLTGMFSAAILLSMAICSTAIIYRGEHMSMYLNASSEFAVYPTDQSLVLVGHLLFLDGQRLPTTNYSGLIELIHYNYS 80 
9629803     1 MAKHTVLFTASILLAISMCATAIIYRGEHMSMYLNASSEFAVYPKDKSLVVVGHMLFLDGQRLPTTNYSGLIELIHHNYS 80 
270339513   1 MSSIAFIY---ILMAIG-TVYGIVYRGDHVSLHVDTSSGFVIYPTLENFTIYGHLIFLDDQPLPVNNYNGTLEIIHYNHH 76 
296316070   1 -MRCLLLFWVAALAARAAPASGLVYRGEAVGLRADGPVAFAVHPADATLALRGRLIFLEHQLPAGRRYNGTVELLRYLVD 79 
216905926  81 SVCYTVIQTISYESCPRVANNAFRSCLHKTSKHNHDYFRVNASVETNVLLNITKPQPTDSGAYILRVKLDHAPTA----- 155
50313314   81 SVCYTVIQTISYESCPRVANNAFRSCLHKTSKHYHDYFRVNASVETNVLLNITKPQPTDSGAYILRVKLDHAPTA----- 155
9629803    81 RGCYSVIQTISYESCPRVANNAFRSCLHKTSNHNQDYFHVNTSVETNVLLNITRPQPADSGAYILRVKLNHAPTA----- 155
270339513  77 SSCYKIVQVIEYSSCPRVRNNAFRSCLHKTSMHQYDQLSINTSVETGMLLTITSPKMEDGGIYALRVRFNHNNKA----- 151
296316070  80 GDCFVMLQATAFASCPRVANDAFRSCLHADTRPARSERRVSAAVENHVLFSIAGPRPADSGLYFLRVGIDGGAEGaerrr 159
216905926 156 DVFGVSAFVYDLK--------SKTVPDPMPTTQTVKPTTSYVSTPTYDYTDAVtTTETESTSTSTQQTMTSTQTPSATLG 227
50313314  156 DVFGVSAFVYDLK--------SKTVPDPMPTTQTVEPTTSYVSTPTYDYTDDV-TTETESTSTSTQQAMTSTQTPSATWG 226
9629803   156 DVFGVSAFVYDLQ--------SNTVPEPVPTAK--EPSNVFTRTPAPAPANT--STKTGSNTTSSQSTWLYTPTPRPALE 223
270339513 152 DVFGLSVFVYSFDmrghrhhaDENLNGEILTTP--SPMETYVKVNTPIYDHMVtTQTTSNKSMESEPS------------ 217
296316070 160 DVFPLAAFVHGFD--------GPGSDDPEAATARPGGAAGAIAAHCERGLNAG-SASLYDRAMAAFPAGAAAATPTPTAD 230
216905926 228 TQLTTELSTNETVVVGREALLCHWFQ-PSTRVPTLYLHLLGRTGNLPEDVLLVEDSEILRTPSPEPRPAASPADGDEFKQ 306
50313314  227 TQLTTELPTNETVVIGQEALLCHWFQ-PSTRVPTLYLHLLGRTGNLPEDVLLVEDSEFLRTTSPAHRPSASPADGDDFKQ 305
9629803   224 THLTTA-PANETVVSGDTAMLCHGFR-PSTAVPTIYMHLLGLTGNLPEDVLLIEDSEILRTPPPKPQTTSSRTEGDDFKQ 301
270339513 218 ----------------NTSISCHTFQnDPNEGETLYTHLLNIAGNITYDDMVMDGTTL---KPRLIDMGLNLSVTSSFKN 278
296316070 231 GGGEGVATPDQAGETSET----------------------GTRASLTPDPAATPTPPATPPAPADNSSSRAPGAAGAAAQ 288
216905926 307 TNSTSLKARNKIVAMVVIPTACVLMLLLVVVGAIINGAVRKHLLSCASRRIYRSGQGGTSAAERRRLTCGPTLAASSESL 386
50313314  306 TNSTSLKARNKIVAMVVIPTACVLMLLLVVVGAIINGAVRKHLLSCASRRIYRSGQGGASAAERRRLTCGPTLAASSESL 385
9629803   302 TNSTSPKSRNKIVAMVVIPTACVLMLLLVVVGAIINGAVRKHFLSCASRRIYRSRQGGVSSSEWSRLACGPTLAASSESL 381
270339513 279 ETTQKWTPDRKVGFVIVISIA--VLLLLAVIGSIINSAIRKHIMVCAGRRIYIPNNDGRPSTEMTRFTRQTKPSNSSSKS 356
296316070 289 SPQDTPARFQRQLASILVPLCVLVLLLLALCAAMANCAMRRRLLPC-SRRIYKPRTCAACGSG----TCAGRPPCRGAAP 363
216905926 387 ADDTTSSPPTPKPSKKTKletdplmeqmqRKLEAIKEES 425
50313314  386 ADDTTSSPPTPKPSKKTKletdplmeqlnRKLEAIKEES 424
9629803   382 ADDTTASPPSHKPTEKPTpesdplleqlnRKLEAIKEED 420
270339513 357 LLDVPRSSNSTPTDGVSR-----------SQLTVINEET 384
296316070 364 IAPATVVTLESRPKAPP--------------LATISEE- 387
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap