Conserved Protein Domain Family
PHA03290

?
PHA03290: PHA03290 
envelope glycoprotein I; Provisional
Statistics
?
PSSM-Id: 165547
View PSSM: PHA03290
Aligned: 2 rows
Threshold Bit Score: 618.188
Threshold Setting Gi: 13242461
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625941    1 MFLIQCLISAVIFYIQVTNALIFKGDHVSLQVNSSLTSILIPmQNDNYTEIKGQLVFIGEQLPTGTNYSGTLELLYADTV 80 
13242461   8 ASIMRYLMVFMLFGIQCAAAIIYRGNYISLYVNSSATSIFLK-GNNNDASIRGRFLFIGDQFPVTNTYNVTVELLHVNQT 86 
9625941   81 AFCFRSVQVIRYDGCPRIRTSAFISCRYKHSWHYGNSTDriSTEPDAGVMLKITKPGINDAGVYVLLVRLDHSRSTDGFI 160
13242461  87 TLCLQPLYRVMYGECPRIRTGAIIACRVKRSWHYENATQ--LTDPNVEIIFKMNNTKVEDAGIYLLVVQLDYTSLFDIFF 164
9625941  161 LGVNVYTAGSHHNiHGVIYTSPSlqngYSTRALFQQARLCDLPATPKGSGTSLFQHMLDLRAGKSLEDNPWLHEDVVTTE 240
13242461 165 VSLNVYPKQDTSN-EDVNYFPPV----YSPSHILNTFKICHKFPVHNGMEQSILQHIVTSDVDTETENLSWQKDDLGSTQ 239
9625941  241 TKsvvKEGIENHVYPTDMSTLPEKSLNDPPENLLIIIPIVASVMILTAMVIVIVISVKRRR-IKKHPIYRPNTKTRRGI- 318
13242461 240 KP---RKNFNPDVKVNVTHETRKTLMESSADVFMIAVPITASLLVILAIIIVVTVGIYRRRsSEKRKIYRPKRTKEQASt 316
9625941  319 -QNATPESDVMLEAAIAQLATIREESPPHSVVNPFVK 354
13242461 317 eKRERSESDVLLEAAVARLETIQEENPPHSVINPFTK 353
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap