Conserved Protein Domain Family
PHA03289

?
PHA03289: PHA03289 
envelope glycoprotein I; Provisional
Statistics
?
PSSM-Id: 165546
View PSSM: PHA03289
Aligned: 3 rows
Threshold Bit Score: 582.649
Threshold Setting Gi: 10834952
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
125745128   1 MYLLQLLFWIRLFRGIWSIVYTGTSVTLSTDQSALVAFCGLDKMVNVRGQLLFLGDQTRTSSYTGTTEILKWDEEYKCYS 80 
12084907    8 CMVCVTLILFCIIIKTQCMVYRGSLVSTTVDQSAQIAFFGIDTVVNLYGKVLFMGDQYLEEIYSGTMEILKWNQANRCYS 87 
10834952   14 ASKKHILCFLFLVTGSHSLIFTGTSLSASTDQSAIVAFCGLDKTVNVYGRLFFLGDSVGVISYDGTTEILRWNEKLKCFS 93 
125745128  81 VLHATSYMDCPAIDATVFRGCRDAVVYAQPHDRVQPFPEKGTLLRIVEPRVSDTGSYYIRVALAGRNMSDIFRMAVIIRS 160
12084907   88 IAHATYYADCPIISSTVFRGCRDAVVYTRPHSRIHPQYRNGLLLTIIEPRMEDSGIYYIRTSIDGFNKSDYARTSIFVCN 167
10834952   94 VMYAALYTDCPLAGSALFRGCRSAVVYATPHDRVKPVSEKGLLLCISDPRISDTGTYYIRVSLAGRNVSDIFRIDVVVTS 173
125745128 161 SKSWACNHSASSFQAHKCIRYVDRMAFENYLIGHVGNLLDSDSELHAIYNITPQSISTDINIITTPFYDNSGTIYSPTVF 240
12084907  168 GSSGSCSNPRQKVSDEMCIPHVNRIAFERYLTLHVGRLPYGDLTLQQIRKDMTTTAPTYRTIRRTTVNEGLLTAKTSPDI 247
10834952  174 SSIHTCGHADKGIQE--CIRYADRVSFENYLIGHVGQLLPVDSELHAVYNVTPRSVVGTNTDTMSAFTNSTTKSASTNLI 251
125745128 241 NLFNNNSHVDAMNSTGMWNTVLKYTLPRLIYfsTMIVLCIIALAIYLVCERCR----SPHRRIYIGEPRSDEAPLITSAV 316
12084907  248 DLNATNLPLPISNYTDYMSVIWRRVALRRIY--AYLVIAIIALLIVTVCSAHKrgscSRRRRIYIGNEPTTLTSITNGNF 325
10834952  252 AMKTTHPP-------STRRCNLRRALPKLIYmsSLAGLCLLVLLIGRAVVKCK----TPKPKIYKGDSTSDGISLINSAV 320
125745128 317 NESfqydyNVKETPSDVIEKELMEKLKKKVELLERE 352
12084907  326 QEK-----ETKNVPSDISDAELLERLEKKIEMLRTE 356
10834952  321 NDAfgcnpAKEVDPSNISEGEKLENMQKTTGNVEK- 355
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap