Conserved Protein Domain Family
PHA03286

?
PHA03286: PHA03286 
envelope glycoprotein E; Provisional
Statistics
?
PSSM-Id: 177576
View PSSM: PHA03286
Aligned: 3 rows
Threshold Bit Score: 879.251
Threshold Setting Gi: 125745129
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12084908    1 MRACRLSILILLLQTISASMIQHLDLLEGQSVAVDIPRYPPLTNGTIYTETWTWISSICNDTSMGYICLDRATCFQDLLL 80 
125745129   1 MCVFQILIIVTTIKVAGTANINHIDVPAGHSATTTIPRYPPVVDGTLYTETWTWIPNHCNETATGYVCLESAHCFTDLIL 80 
155042204   1 MSCPRMPLFLMAAMMCSATTVNRILIPQGNSATLKISRYPPVVDGTPYTETWTWISNRCNETATGYVCLDSVNCFHDLIV 80 
12084908   81 GTSCVRYGEEKILRVDRFVVNSGSLDRIASSQFHYIPNVIIGTGRGKELTIFNATSQIAGVYTRYTRNDSRPAVMDVLLV 160
125745129  81 GVSCMRYADEIVLRTDKFIVDAGSIKQIESLSLNGVPNIFLSTKASNKLEILNASLQNAGIYIRYSRNGTRTAKLDVVVV 160
155042204  81 KMACWRYSKEVILRTARFVVERGVLKTIETAKLRNAPRVLIVDNVDTQWTVLNASEQNAGIYIRYSRNGTRTAHVDAIVL 160
12084908  161 WVSVHGQAPDRTMNIYITPPSTRVDLTFKNFNAFLFNAGDTVDASVTAHLTNWAGAFSLEFKLLFLPYNSKCLYLTVYEP 240
125745129 161 GVLGQARDRLPQMSSPMISSHADIKLSLKNFKALVYHVGDTINVSTAVILGPSPEIFTLEFRVLFLRYNPTCKFVTIYEP 240
155042204 161 AVSGRKRGRVPPTVYPVGPFLHKFQISLKNFKTFLYQVGDTVTISITTRLETTVRAFKLEFRVMFLPYSPNCKSFTIYEP 240
12084908  241 CIFHPSESECQMVPEHAECRFAANMDVMQLASARTDGCRVDVRGCTFQTSVDESVQGKLAFLESDVPSFRLANAQPTDAG 320
125745129 241 CIFHPKEPECITTAEQSVCHFASNIDILQIAAARSENCSTGYRRCIYDTAIDESVQARLTFIEPGIPSFKMKDVQVDDAG 320
155042204 241 CIFHPKEPECISPSELSECRFASNAQVLEIAAARSVNCSAG-RACHYDAEVDESMQQRFAFLYSEIPSFTIGNAGPGDAG 319
12084908  321 LYVIVGLYNGRPLAWTYVYLSTLETILNVFEDVHKPGFGYNAVSAD----TPGNFTAAPTHTSAFKEGPTVIYSLLVSSM 396
125745129 321 LYVVVALYNGRPSAWTYIYLSTVETYLNVYENYHKPGFGYKSFLQNssivDENEASDWSSSSIKRRNNGTIIYDILLTSL 400
155042204 320 LYVVVALCDERPTTWTHVYLSTLDKILDVHEIAHKPGFDDRVLSSN----DDAARGVRPGAAIEKESGRLRLSGALIASI 395
12084908  397 AAGVILVLLLFALLIVGLYK-RHARHRTNGYFQAYPKYSSLPSNDEcvfgdGDFNSPLSNTCEGLSRGLAgNSKSRTPKQ 475
125745129 401 SIGAIIIVIVGGVCIAILIR-RRRRRRTRGLFDEYPKYMTLPGNDL-----GGMNVPYDNTCSGNQVEYY-QEKSAKMKR 473
155042204 396 VLVAAAVVTTVSFCGACVFRwRRRCHRKTQAPGNSCKYMSLPQNHW-------------------------EEFYDDVRV 450
12084908  476 KGSRYHAWFADGGPAATIRRREV 498
125745129 474 MGSGYTAWLKNDMPKIRKRLDLY 496
155042204 451 GSALSMSSLTKGCPRERDQATPL 473
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap