Conserved Protein Domain Family
PHA03282

?
PHA03282: PHA03282 
envelope glycoprotein E; Provisional
Statistics
?
PSSM-Id: 165539
View PSSM: PHA03282
Aligned: 5 rows
Threshold Bit Score: 786.052
Threshold Setting Gi: 9629449
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629449    1 MDRGAVVGFLLGVCVVsclAGTPKTSWRRVSVGEDVSLLPAPGPTGRGptQKLLWAVEPLDGCGPLHPSWVSLMPPKQVP 80 
9629338    1 MARGAGLVFFVGVWVVsclAAAPRTSWKRVTSGEDVVLLPAPAERTRA--HKLLWAAEPLDACGPLRPSWVALWPPRRVL 78 
30984495   7 ASLGLLVAWAIGACVC---AAAIETTWKHASAGDEVRLFALPAARPGAppAKVVWELDPMAACGSLRPSWVSLRPPGQVL 83 
56694790   6 APRGLLAAWILAAWVG---VAAVETTWKHASAGDDVVFFDLPAGRPGGppRELAWEFASMRNCGPLRPSWVSLHPPGQVL 82 
83722636   6 VLRGLLAAWVLAAWGG---VAAVETTWKHASAGDDVRFFDLPAGRPGDppRGLAWGFEPMQNCGPLRPSWVSLRPPGRVL 82 
9629449   81 ETVVDAACMRAPVPLAMAYAPPAPSATGGLRT----DFVWQERAAVVNRSLVIHGVRETDSGLYTLSVGDIKDPARQVAS 156
9629338   79 ETVVDAACMRAPEPLAIAYSPPFPAGDEGLYS----ELAWRDRVAVVNESLVIYGALETDSGLYTLSVVGLSDEARQVAS 154
30984495  84 DTVVDAECVSEPVLLAAWYERRDGGSEVP-APfwgpDGAPPQRGNVTNGTLVLREARVGDSGMHVLSVFHPPNATAARHV 162
56694790  83 ETVVDAQCVGAPRLMAAWYGRPDGAP----APg--pEAAWPPRVSVSNGTLTLREARPSDSGMYVLTVSRAPNSTAARRV 156
83722636  83 ETVVDAECVGAPRLMAAWYGRPPNETRAPLAPg--pEEAWAPRVSVRNGTLMLLEARPSDSGMYVLTMSRAPNSTAARRV 160
9629449  157 VVLVVQPAPVPTPpptPADYDEDDNDEgedeslAGTPASGTPRLPPPPAPPRSWpsAPEVSHVRGVTVRMETPEAILFSP 236
9629338  155 VVLVVEPAPVPTP---TPDDYDEEDDAgvtnarRSAFPPQPPPRRPPVAPPTHPrvIPEVSHVRGVTVHMETLEAILFAP 231
30984495 163 VFLKVAPR-RPEPaggTPPPRDDEEGG------TEEPATPAPP------PHPHP--IAEVAHVRGVTVSLRTQTAILFAP 227
56694790 157 VFLTVGPRVAAAVpggPPPLAEGAGAE------AGAAATRAPAAHPYPYPHPHP--IAEVAHVHGVTVSLRTQTAILFSP 228
83722636 161 VFLTVGPRGAPGApdgTPPPHAEAGGG------VGADATPAPAVH----PHAHP--IAEVAHVRGVTVSLRTQTAILFSP 228
9629449  237 GETFSTNVSIHAIAHDDQTYSMDVVWLRFDVPTSCAEMRIYESCLYHPQLPECLSPADAPCAASTWTSRLAVRSYAGCSR 316
9629338  232 GETFGTNVSIHAIAHDDGPYAMDVVWMRFDVPSSCADMRIYEACLYHPQLPECLSPADAPCAVSSWAYRLAVRSYAGCSR 311
30984495 228 GDTVHTDVSVMPIAHDDDPYVMEVVWVRFDVPEECGEMRIYEPCLYHPQLPECRSPADAPCAASVWTERLAVRRYGPCSR 307
56694790 229 GDTVHTAVSIVPLAHDDDPYVMEVVWVRFDVPEECGEMRIYEPCLYHPRLPECRSPADAPCAASVWTERLAVRRYGPCSR 308
83722636 229 GDTVHTAVSIVPLAHDDDPYVMEVVWVRFDVPEECGEMRIYEPCLYHPRLPECRSPADAPCAASVWTERLAVRRYGPCSR 308
9629449  317 TNPPPRCSAEAHMEPVPGLAWQAASVNLEFRDASPQHSGLYLCVVYVNDHIHAWGHITISTAAQYRNAVVEQPLPQRGAD 396
9629338  312 TTPPPRCFAEARMEPVPGLAWLASTVNLEFQHASPQHAGLYLCVVYVDDHIHAWGHMTISTAAQYRNAVVEQHLPQRQPE 391
30984495 308 GVPPPRCPSDAAMESRAGLGWYGHTVNLQLRDASEASGGLYVCVVYVNGHVHAWGHVVISTASRYRNAVVERSPPRYRPP 387
56694790 309 SVPPPRCPTDAAMEARPGLGWYGPTVNLQLRDASEASGGLYVCVVYVNGHVHAWGHVVVSTAARYRNAVVERSLPRYRPP 388
83722636 309 RAPPPRCPADAAMEARPGLGWYGHTVNLQLRDASEASGGLYVCVVYVNGHVHAWGHVVVSTAARYRNAVVERSLPRYRPP 388
9629449  397 LAEPThPHVGAPPHAPPTHGALRLGAVMGAALLLSALGLSVWACMTCWRRRAWRAVKSRASGKgPTYIRVADSELYADWS 476
9629338  392 PVEPTrPHVRAPHPAPSARGPLRLGAVLGAALLLAALGLSAWACMTCWRRRSWRAVKSRASATgPTYIRVADSELYADWS 471
30984495 388 PVEPT-PSAQPTGPRPAAPRAARLVGVLGAAVGLAVAGLSVWACVTCRRARAWRAVKRRDLMA-PTYIRLADDELYGDLS 465
56694790 389 PAAPT-PSARPQGPRPALRSP-RLVGVFGAALGLAAAGLSVWACVTCRRARAWRAVKKRDPGT-QTYIRLADDELYADLS 465
83722636 389 PVEPT-PSARPSGPRPAPRSL-RLVGVFGAALGLAVAGLSVWACVTCRRARAWRAVKKRDLGA-PTYIRLADDELYADLS 465
9629449  477 SDSEGERDQVPWLAPPERP--DSPSTNGSGFEILSPTAPSvyPRSDGHQSRRQLTTFGSGRPDR-RYSQASDSSVFW 550
9629338  472 SDSEGERDGSLWQDPPERP--DSPSTNGSGFEILSPTAPSvyPHSEGRKSRRPLTTFGSGSPGR-RHSQASYPSVLW 545
30984495 466 SYGDSDDSE-YDSDSDRLPgtDPAPKRGSGFQILSGAKAD--PWSAGARQHGHLITFRADDTSRyRDPSSPDPPHRR 539
56694790 466 SDGGWEDSEDDDSDDDRLPgtDRPPKRGSGFQILSGTKAD--PWSPEARRGRDLVTFRVDDAARyRDASPPDPPHRR 540
83722636 466 SDGASDDSE-YDSDDDRLPgtDRPPKRGSGFQILSGTKSD--PWSPGARRSRDLVTFRVDDTTRyRDAPSPDPPHRR 539
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap