Conserved Protein Domain Family
PHA03281

?
PHA03281: PHA03281 
envelope glycoprotein E; Provisional
Statistics
?
PSSM-Id: 165538
View PSSM: PHA03281
Aligned: 2 rows
Threshold Bit Score: 1131.72
Threshold Setting Gi: 13242462
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625942    1 MGTVNKPVVGVLMG---FGIITGTLRITNPVRASvlryDDFHTDEDKLDTNSVyepyyhsdhaesswvnrGESSRKAYDH 77 
13242462   3 MTVVKHVMLTLICGtlsWGVQINTLAYASAIKSE----DGFDMDEDGVYGDDI-----------------QDYINAAYTH 61 
9625942   78 NSPYIWPRNDY------DGFLENAHEHHGVYNQGRGidsgerlmqptQMSAQEDLGDDTGIHVIPTLNGDDRHKIVNVDQ 151
13242462  62 ERPFIQDKSKHkmetytQSLLHTDLETDSQISRERG-----------NYINAQELGDGNNEHVDLVNRTMTKNVLMKHGH 130
9625942  152 RQYGD---VFKG--DLNPKPQGQRLIEVSVEENHPFTLRAPIQRIYGVRYTETWSFLPSLTCTgDAAPAIQHICLKHTTC 226
13242462 131 RNFMDasiLYKSvhGITHLHAHQRPTEVSVAENQQLLLKVHIPQENEHTYTERWSFLPAAPCK-LTPPSIQQVCIKHGAC 209
9625942  227 FQDVVVDVDCAENTKEDQLAEISYRFQGKKEADQPWIVVNTSTLFDELELDPPEIEPGVLKVLRTEKQYLGVYIWNMRGS 306
13242462 210 IHDVVVDVDCIAESMEHTLVEIGYVVHASKAVHPTWTVVNITEDFANYGFDTPDVKPGVLKFEHMNAHHAGVYIWNLQGT 289
9625942  307 DGTSTYATFLVTWKGDEKTRNPTPAVTPQPRGAEFHMWNYHSHVFSVGDTFSLAMHLQYKIHEAPFDLLLEWLYVPIDPT 386
13242462 290 HGENMYVTFLVKLNNSIENHIDLPAVTPKPKGAEFHTWHYHSHVFSVGETFSLPMHLQYKIHDTPFDLLLEWLYVPINPT 369
9625942  387 CQPMRLYSTCLYHPNAPQCLSHMNSGCTFTSPHLAQRVASTVYQNCEHAdNYTAYCLGISHMEPSFGLILHDGGTTLKFV 466
13242462 370 CQPMRLYSACVYHETVPSCLSPENPECTFASPHIARRVANTVYQNCEHV-NYTADCLAVSHVEPGSGLEIQNGGSALLFV 448
9625942  467 DTPESLSGLYVFVVYFNGHVEAVAYTVVSTVDHFVNAIEERGFPPTAGQPPATTKPKEITPVN----PGTSPLLRYAAWT 542
13242462 449 NAAESMSGLYVFIIHFNGHVETVAYTVVSTIENFVNAIEEHGFPPEIHNVPSPSSPNVTANNDviseTNTFPFKTYAGIT 528
9625942  543 GGLAAVVLLCLVIFLICTAKRMRVKAYRVDKSPYNQSMYYAGLPVDDFEDSESTDTEEefgnaiGGSHGGSSYTVYIDK- 621
13242462 529 GGFAVLALVCLALALVCTKRKFGHRSYWSDKAAYGQSTYYAGVPVDDFEDDTEVEVDE------GAECGGSGYTVYIDKr 602
9625942  622 TR 623
13242462 603 TR 604
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap