Conserved Protein Domain Family
PHA03279

?
PHA03279: PHA03279 
envelope glycoprotein K; Provisional
Statistics
?
PSSM-Id: 165536
View PSSM: PHA03279
Aligned: 2 rows
Threshold Bit Score: 552.73
Threshold Setting Gi: 57790933
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38638198   1 MSRVQCLRLAAVIASISHLIFLVWFVCWNSVLENNEDCVYATRSLaaqvqlgelganmstetRLRIRGAAA-EPVSVGP- 78 
57790933   1 MLRPECLKWAVILTGTIHIVFLVWYVCSKISTDSKDDCLYVLANI-----------------KWLLPGQQEfNPVHQPPa 63 
38638198  79 -FNRSLVYVINSDASLLySPRETQDGRCFANTFHKTDMAAVMKVYPDGKNVVLVLEMADCMAYLWFFQVRTATAALLMYL 157
57790933  64 tFNSSLVYVLTKYTQRL-NNYENHQTRCVKGAYFENETVLISRLIPLAKEQYSSWKWQTVSLHMVFPDQSCISTVIVHML 142
38638198 158 afLCVNRQRRGFGPwLDSASRVSAEAYYLNYWTTLAARVFLKVRYLKLSRFLREIEYRREQTWRQFSIDTLGFYLMHPLA 237
57790933 143 --LADPCQRRMFGS-VCRENALRLDAYHLNYWTAFTSRLILRVPYTKMQRFLREFEHVRDCKSLNYVADPLGFCICNPGV 219
38638198 238 LLLRAIETILYFASLVASATVLRVNFDPCSVVLPNHVKVFAWVFVAALGALEVVSAIDHlrreTRSARDAAAVIRPTNII 317
57790933 220 LVLKTLEIGLYLASLIMSTMTLRICYDPCAYILHEHVKISAWVYVIVSAVLELLSLMGY----TTPAKTKVSASKPPSIL 295
38638198 318 AACCANIISHVLLRMLYGAALVLVVIGALKYEREIQTRLLG 358
57790933 296 TSCLANIASSLVLRALCVAAIASIVIIAFKYEQKIQNKLFG 336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap