Conserved Protein Domain Family
PHA03278

?
PHA03278: PHA03278 
envelope glycoprotein K; Provisional
Statistics
?
PSSM-Id: 177574
View PSSM: PHA03278
Aligned: 7 rows
Threshold Bit Score: 369.845
Threshold Setting Gi: 296316007
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10834925    1 MPGRTSIALSGIILCISTYAIALVIYTTMIAKHGSGCIYAVLVDSDHRDAk-NFTWEPYNSTLVYTPLGNKLPLDg-gFG 78 
12084883    1 MSYRPTIGVIAIIISMCMYMTVLIMHLSRLTKGGGDCIYAISTGGKLSTE--NFTWERYNSTLIYTPLQGKFLMD---GE 75 
125745106   1 MSIRTSIALIGILFAISIYTVLLVVYVSTLSQNGSGCIYATLVDSSLYDAk-NFTWEQYNSTLIYTALGNKLPLDg-gFD 78 
51557487    1 MLLGGRPLHLLVLGVMGAYAGLGAYY-ATVARLPHPVVYAALPLGEDAAGg-APDWEAFNATAIYVAPNETDALS----- 73 
270339445   1 MFIGGKPSHIIILTLITTYAVFTVWY-SIHANTINKCVYATVPLDGPSIK--NFSWTVYNTSLIYVLSSSGNYANydgLS 77 
255683139   1 ---------MALLLLATTYTVFLLWFGTNGMVGRHWCVYAVSPIENASSGalNVTWEAYNETQLFISSPNGASMT----N 67 
296316007   1 MLLGGRTANLAALALLTAHLALALWA-ALAAPLRERCVLASGANG-------SLRWELRDPGAVYVWGGADNATR----- 67 
10834925   79 GFSDVCNTYLINATDLFGRASHASAKSKIRSVVGTRNCAAYFWKTHIQALTFSLSSYIMFCVIREWRRMFGVVRSENDRI 158
12084883   76 NLDDTCRSHLVNSSAVNKLSEYVLIDTKVRFVKEARNCVAYIWKYRIRPLCFALALYVIAFNVRKWRCMFGVVRNDRDSI 155
125745106  79 DFSDVCRTYLVNLTSISGLASHVSTKPKIRSVVGTRNCVTYLWRIHIQSLSSSLGLYTIFYVIREWRRMFGVVRFEDDAI 158
51557487   74 ----------------------PALRDRARVVYARRDCRAYLWDVHFRLAAVAWLLYAAFVYARQERRMFGPFRDPAEFL 131
270339445  78 GYDYICRKDLALEPKIRAIEGDENVKRRMRIVMGTRNCQAYLWCVHLKLITITWIFYITFMFLRHERRIFGPFRDRCEFI 157
255683139  68 KFDAICGVDVLDKTAAASLNRNQAIRNRIRIVSAARNCVASIWTTHFFFASLTVMFYATFICMRQHRRMFGVFRVQKEFI 147
296316007  68 AIDAPCLHALVRRIPPGLLDGDEALRGRVRAVAGARDCRAYLWSAQARGALLAWLLYVAFVYLRQARRMFGLCRNDADLL 147
10834925  159 PPTTYTKNYTARVIANGLLKTVYTRMSEFMCEITIYKNSMCRIFTDDPISFILRHPLAAILLITERLIRLGGQCLCVLTV 238
12084883  156 SAIMYTKNYASRVISNLWLKTTYCKIYKLMHEINFFKKALSRAFKEDPITFTFSHKVAACLIILECMIRVCAQCVTISII 235
125745106 159 STARYTKNYAARVISSVLLNTTYTKMSRFMCEIMIYKNALSRTFKDDPISFLFHHPIAAVLIITEGLVRLGAQCLCLATL 238
51557487  132 TPEKYTLNYAASVLAATVIGCSYTKFAWYMAELATRRAALSRDLREDPITLAHRHPTLIALILLELGLRLGARMALFTTL 211
270339445 158 HPAGYTLNYTTRVISQTLLHCHYTKFARLMCEVSIQRQFLSQQFKIDPVTFLYKHPYIAIFIAVETAMHLTAKVVLMGTV 237
255683139 148 SPTRYPLSYAVRVIASNVAGCKYSKMARLMCELATIRSSFSRGFVNDPITSSVRHKTTAVLFLLEVTTHGIAQCCVMMAF 227
296316007 148 SPGGYTLNYAAAALAAMAGHGPYTKLARLMCELSARRRALAADFRLDPLGCAWRHPGLLLPLLAEGLARLGARVAAAGSV 227
10834925  239 SIFFVPCKIVLSKWFLSITGVFLGIVICTEMGLLIDPGPAEKPVMFAEVAPAPKTQQNGvavpfGAHAVCSNCCASIISS 318
12084883  236 SIFFVPCETILSTWVLIVTGVFVGIIICIELSLVCSPSPEVSSSFNVNVKEMAGQLNVEtr--wSVCTIFSNCCAAVVSG 313
125745106 239 SMYFVPCEKVLSKWFLSITGIFIGIIICIELSLLLAPGPVDGAAMLGETKQVKKDECALetspsGVHVFCSNCCASLISN 318
51557487  212 GVTRAPCALVFPLYARALVWIFVLAVGALELLAATLPHIARVSGATATPARSDGGR--------AALGVCGACCSTVLAG 283
270339445 238 ALVYTPCAQTYPLYVKILAWIFVSAVFLVDVIAIFYNRPQKPKEGSEDAVSRSRG---------GTNGIFTNCCSTILAG 308
255683139 228 SALHGPCAAAYPLYFKVITGIYVAIVAIVELFVMLTPGPTDKKIMVGETTERKQSRVMS-----GLTSVCANCCATLMSG 302
296316007 228 GVAHAPCAAAYPMYLKIWAWVHVAAFAALELVSLLYRKPPRRRAGGGAAGDGES----------GIRKVCVNCCSTLLAG 297
10834925  319 IVIKVLYVLFMVTLIVTLVRYERALQIALFGRAYLP 354
12084883  314 IFLKAIYFLFMITAIVIIVRYERALQIALFGRAYLP 349
125745106 319 ILIKVLYILFMIILIVTIVRYERTLQIALFGRAYLP 354
51557487  284 IFAKALYLCLLVGGVLLFLHYER--HITIFG----- 312
270339445 309 LMVKIFYVSIIIGAVVVLLRYEQRIQINLFGSGDTK 344
255683139 303 LFVKLLHLASIIGLVFLFLWYERKVQEMLFSA---- 334
296316007 298 LLVKALYLAAIVGGVVALLHYEHSLRLQLLGAQT-- 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap