Conserved Protein Domain Family
PHA03276

?
PHA03276: PHA03276 
envelope glycoprotein K; Provisional
Statistics
?
PSSM-Id: 165533
View PSSM: PHA03276
Aligned: 5 rows
Threshold Bit Score: 592.262
Threshold Setting Gi: 83722623
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629435    1 MLAVRSLQHLSTVVLITAYGLVLVWYTVFGASPLHRCIYAVRPTGTNNDTALVWMKMNQTLLFLGAPTHPPNGGwRNHAH 80 
9629324    1 MLAVRSLQHLTTVIFITAYGLVLAWYIVFGASPLHRCIYAVRPAGAHNDTALVWMKINQTLLFLGPPTAPPGGAwTPHAR 80 
30984482   1 MLAVRSLRHLTTLCLVTAYGLVLGWYVVFGANPAHRCIYAVRPVGAGNDTAPAWMRTNKSLLFLSGGRPPAEDP-RDPTA 79 
56694777   1 MLAVRSLRHLTTLCLVTAYGLVLGWYVVFGASPARRCIYAVRPVGASNDSAPAWMRVNKSLLLLSGERAPPEDP-RDPAA 79 
83722623   1 MLAVRSLRHLTTLCLVTAYGLVLGWYVVFGASAAHRCIYAVRPAGASNDSAPTWMRVNKSLLFLSGGRAPPEDP-RDPTA 79 
9629435   81 ICYANLIAGRVVPFQVPPDAMNRRIMNVHEAVNCLETLWYTRVRLVVVGWFLYLAFVALHQRRCMFGVVSPAHKMVAPAT 160
9629324   81 VCYANIIEGRAVSLPAIPGAMSRRVMNVHEAVNCLEALWDTQMRLVVVGWFLYLAFVALHQRRCMFGVVSPAHSMVAPAT 160
30984482  80 LCRGDVIGGHAVSLPAAPPGSGPRVMIVQEAVNCLAALWDTQVRLIAVSWFLYLAFVTLHQRRCMFGVVSPAHKMVAPAT 159
56694777  80 LCRGDVIGGHAVS---PPPGSGLRVVVVHEAVNCLAALWDTQVRLVATSWFLYLAFVALYQRRCMFGVVSPAHKMVAPAT 156
83722623  80 LCRADVIGGHAVSLPPGSGGAGLRVMVVHEAVNCLAALWDTQVRLIATSWFLYLAFVALYQRRCMFGVVSPAHKMVAPAT 159
9629435  161 YLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQNLVQLFETDPVTFLYHRPAIGVIVGCELMLRFVAVGLIVGTAFISR 240
9629324  161 YLLNYAGRIVSSVFLQYPYTKITRLLCELSVQRQTLVQLFEADPVTFLYHRPAIGVIVGCELLLRFVALGLIVGTALISR 240
30984482 160 YLLNYAGRVVSSVLLRYPYTKITRLLCELSVQRQSLVEIFEADPVTFLYHRPAIGTAVGCEILLRVASQGLIASTAIVPW 239
56694777 157 YLLNYAGRVVSSVLLRYPYTKLTRLLCELSVQRQSLVEIFEADPVTFLYHRPAIGTAVACEILLRLASQGLIVSTAVVPW 236
83722623 160 YLLNYAGRVVSSVLLRYPYTKITRLLCELSVQRQSLVEIFEADPVTFLYHRPAIGTAVACEILLRVASQGLIASTAIIPW 239
9629435  241 GACAITYPLFLTITTWCFVSTIGLTELYCILRRGPAPKNADKAAAPGRSKGLSGVCGRCCSIILSGIAVRLCYIAVVAGV 320
9629324  241 GACAITHPLFLTITTWCFVSIIALTELYFILRRGSAPKNAEPAAPRGRSKGWSGVCGRCCSIILSGIAVRLCYIAVVAGV 320
30984482 240 GACAIAYPLFLNIITWCFVSAILLAEAYFVARGESAPPGSEKGPRPPKRGGLAGICGRCCSIILSGIAVRLCYVAIVAVV 319
56694777 237 GACAIAYPMFLNIITWCFTSAILLAELYFVIRGDSAPPGPEKGPRPPKRGGLAGVCGRCCSIILSGIAVRLCYVAVVAVV 316
83722623 240 GACAIVYPLFLNIVTWCFASAILLAELYFVVRGDSAPPGPERGPRPPRRGGLAGVCARCCSIILSGIAVRLCYVAVVAVV 319
9629435  321 VLVALHYEQEIQRRLFDV 338
9629324  321 VLVALRYEQEIQRRLFDL 338
30984482 320 VVVAFRYEQEIQRRIFDT 337
56694777 317 VVVAFRYEQEIQRRIFDA 334
83722623 320 VVVAFRYEQEIQRRIFDA 337
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap