Conserved Protein Domain Family
PHA03275

?
PHA03275: PHA03275 
envelope glycoprotein K; Provisional
Statistics
?
PSSM-Id: 177573
View PSSM: PHA03275
Aligned: 6 rows
Threshold Bit Score: 411.104
Threshold Setting Gi: 9629821
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
216905859   1 MLFGGRTAYLSVLGLITAYAVFTIWYTLTAQLHN-PCVYATVSIdskDGIAAKWEVYNSTIVYAYPENGAKRFSDGLSGF 79 
50313247    1 MLLGGRTAYLSVLGLITAYAAFTIWYTLTAQLHN-PCVYATVSIdskDGIAAKWEVYNSTIVYAYPENGAKRFSDGLSGF 79 
9629788     1 MLFGGRTAYLSVLGLITAYAAFTVWYTLTAKLHN-PCVYATVSIdskDGIATRWEVYNSTIVYAYPKNGAKRFGDGLSGF 79 
9625880     2 QALGIKTEHFIIMCLLSGHAVFTLWYTARVKFEH-ECVYATTVI---NGGPVVWGSYNNSLIYVTF-VNHSTFLDGLSGY 76 
13242443    2 QALGIKTEHFIIVCLLMTYLLFVLWYTSRIQFRN-VCVYATAPV---QGGKVIWNLYNSSLIYVTV-TNHSLFLDGLSGY 76 
9629821     1 MLLGGRTVNLAALALLTAHLALALWVALAARCQRcACVRATA-----RNGSLRWELRSPGAVYVWGGANNATLAA----- 70 
216905859  80 DYVCRENWVNESKLDVLKNMKELHDKVRIVVGTRNCRAYLWSVQLQMITGAWLIYIAFLCLRQERRLLGPFRNQNEFLSP 159
50313247   80 DYVCRENWVNESKLDVLKNMKELHDKVRIVVGTRNCRAYLWSVQLQMITGAWLIYIAFLCLRQERRLLGPFRNQNEFLSP 159
9629788    80 DYICRENWVNETKLDVLKNMKELHDKVRIVVGTRNCKAYLWSVQLQMIIVAWIIYIAFLCLRQERRLLGPFRNQNEFLSP 159
9625880    77 DYSCRENLLSGDTMVKTAISTPLHDKIRIVLGTRNCHAYFWCVQLKMIFFAWFVYGMYLQFRRIRRMFGPFRSSCELISP 156
13242443   77 DDSCRKDLINGDSILPTVFSSPLHEKIRVVLGTRNCRAYMWCVHLKIIIINLFVYAVYLQCRRVRRMFGPFRKACEFISP 156
9629821    71 DAPCRHAVVQHIPPGLLDGDEALHGRVRAVAGARDCRAYLWCAQARGGLLAWLLYVAFVYLRQERRMFGLCRNDADFLSP 150
216905859 160 TGYTFNYATYTLATTVLKTHYTKFALLLCEASLRRVALSRTFKRDPIGFLCEHSAALALIGLEVGTHFVARLLVVGTVTL 239
50313247  160 TGYTFNYATYTLATTVLKTHYTKFALLLCEASLRRVALSRTFKRDPIGFLCEHSAALALIGLEVGTHFVARLLVVGTVTL 239
9629788   160 TSYTFNYAAYTLATTVLKTHYTKFALLLCEASLRRVALSKTFKRDPIGFLCEHTAALALIGLEVGAHLFARILVVGTVTL 239
9625880   157 TSYSLNYVTRVISNILLGYPYTKLARLLCDVSMRRDGMSKVFNADPISFLYMHKGVTLLMLLEVIAHISSGCIVLLTLGV 236
13242443  157 MSYSLQYTTSVISTTFLKFPYNKLTKLLHEVESQRNAISSMFMYDPISFLCLNKLIGLLIAFEIFVHIISGCVLL-TLGI 235
9629821   151 GGYTLNYAAAALAAVVGHGPYTKLARLMCELSARRRALAVDFRLDPLGCAWRPRAALPLLA-EGFARLGARIAAAGSVGI 229
216905859 240 VHTPCSQIYPIYLKLASWGFVLAVTIVEIVAIIYEKPPKTGSSAIPPTPATH--GVKGLCTSCCSTVLANLCGKMVYLLL 317
50313247  240 VHTPCSQIYPIYLKLASWGFVVAVTIVEIVAIIYEKPPKTGSSANPPTPATH--GVKGLCTSCCSTVLANLCGKLVYLLL 317
9629788   240 VHTPCSQLYPIYVKIASWGFVIAVTIVEIVAIIYEKPPKPGSNVSPPAPMVH--GVKGLCTSCCSTVLANLCGKIVYLLL 317
9625880   237 AYTPCALLYPTYIRILAWVVVCTLAIVELISYVRPKPTKDNHLNHINTG-----GIRGICTTCCATVMSGLAIKCFYIVI 311
13242443  236 VYTPCSLLYPLYVRIVAWMFTGLIFGVEMVACVRSKSNNENNENNGSTVNPK--GLHGVCTACCATVISGLAVKCIYVAV 313
9629821   230 TH-PCAAAYPLYLKIWAWVHVALFAGLELVSLLYRKPRRRGGTCAGDGGDGGesGIRKVCVNCCSTLLAGLLVKALYLAA 308
216905859 318 VIGAVSILLHYEQRIQIGLLGESFSS 343
50313247  318 VIGAVSILLHYEQRIQIGLLGESFSS 343
9629788   318 VVGAVSILLHYEQRIQIGLLGESLSQ 343
9625880   312 FAIAVVIFMHYEQRVQVSLFGESENS 337
13242443  314 FAIAVIVFMHYEQRVQVSLFWHIR-- 337
9629821   309 IVGGVIALLHYEHNLRLRLLGAQT-- 332
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap