Conserved Protein Domain Family
PHA03270

?
PHA03270: PHA03270 
envelope glycoprotein C; Provisional
Statistics
?
PSSM-Id: 165528
View PSSM: PHA03270
Aligned: 5 rows
Threshold Bit Score: 700.534
Threshold Setting Gi: 83722613
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629425    1 MAPGRVGLAVVLWSLLWLgagvsggsetASTGPTITAGAVTNASEAPTSGSPGSAASPEVTPTStpnpnnvTQNKTTPTE 80 
9629314    1 MALGRVGLAVGLWGLLWVgvvv--vlanASPGRTITVGPRGNASNAAPSASPRNASAPRTTPTPpqp-rkaTKSKASTAK 77 
30984472   2 AGWRAAGSGLCLFVLMWL----------LCAGAGAPRGAASTPAGRPGASRPGGVERANRTAAP-------ARGRGSSNG 64 
56694767   2 VGRRAAGLGLGLGLLMWL----------LCAGEGAPRAASSTP-----------ARGNRTLPGP-------ARGNRTLPG 53 
83722613   2 AGWRAAGLGLLM--LTWL----------LCAGAGAPRGG---------------AEGTTRAVAP-------SRGRGNGTR 47 
9629425   81 PASPPttpkptstpkspptstpdpkpknnttpaKSGRPTKPPGPVWCDRRDPLARYGSRVQIRCRFRNSTrMEFRLQIWR 160
9629314   78 PAPPP----------------------------KTGPPKTSSEPVRCNRHDPLARYGSRVQIRCRFPNSTrTEFRLQIWR 129
30984472  65 TG-----------------------------------PGSTSAQFRCKRPDVSALYGSRVVIGCRLPRPT-ADFRLQIWR 108
56694767  54 PA-------------------------------RERPTKSPPVPFRCKRPDVSAHYGGRVAVACRFPRPT-GEFRLQIWR 101
83722613  48 PGGGS----------------------------PARAPGSAPAPFRCKRPDVVALFGGRVAMGCRVPRPT-ADFRLRIWR 98 
9629425  161 YSMGPSPPIAPAP-DLEEVLTNITA-PPGGLLVYDSAPNLTDPHVLWAEGAGPGADPPLYSVTGPLPTQRLIIGEVTPAT 238
9629314  130 YATATDAEIGTAP-SLEEVMVNVSA-PPGGQLVYDSAPNRTDPHVIWAEGAGPGASPRLYSVVGPLGRQRLIIEELTLET 207
30984472 109 VAAAAHTE----PvEPGAVLVNVTA-PPDGELVYDSAPNRTEARVRWAEGAGPDARPRVYSIEGTFPTQRLVIQELTVAR 183
56694767 102 VAPAGGEDDRLGPiEPGAVLVNVTV-PAGGRLVYDSAPDRAGERVRWAEGAGPGAHPPLYSVDGTFPTQRLVVHELTRAT 180
83722613  99 VAAPRAEAGRPEPaEPGAVLVNVTApPPDGELVYDSAPGATGARVRWAEGAGPDARPRVYALEGTFPTLRLVIQELTLAR 178
9629425  239 QGMYYLAWGRMDSPHEYGTWVRVRMFRPPSLTLQPHAVMEGQPFKATCTAAAYYPRNPVEFVWFEDDHQVFNPGQIDTQT 318
9629314  208 QGMYYWVWGRTDRPSAYGTWVRVRVFRPPSLTIHPHAVLEGQPFKATCTAATYYPGNRAEFVWFEDGRRVFDPAQIHTQT 287
30984472 184 QGLYLWIRGPAERPLRYGTWTRVRMLRRPSLSIRAHTVLEGEPFGATCVAANYYPGDRAAFRWFEGGGEVVAPERVQTRV 263
56694767 181 QGSYLWTRGPPEHPHRYGTWTRVRMVRRPSLSIRPHTVLEGEPFGATCVAADYYPGDGAAFRWFEGGDEVAAPERVRTRV 260
83722613 179 QGWYFWARGPADQPLRYGTWTRVRMLRRPSLSIRPHAVLEGEPFGATCVAANYYPGDRAAFRWFEGGDEVAAPDRVRTRV 258
9629425  319 HEHPDGFTTVSTVTSEAVGGQVPPRTFTCQMTWHRDSVTFSRRNATGLALVLPRPTITMEFGVRIVVCTAGCVPEGVTFA 398
9629314  288 QENPDGFSTVSTVTSAAVGGQGPPRTFTCQLTWHRDSVSFSRRNASGTASVLPRPTITMEFTGDHAVCTAGCVPEGVTFA 367
30984472 264 DAQRNGFSATSTLTSEARAGLAPPRNLTCEFTWHRDSVSFSRRNATGAPTVLPRPTIEMEFGSGEAVCTAACVPEGVELQ 343
56694767 261 DARRDGFSATSTLTSEARAGLAPARNLTCEFTWHRDAVSFSRRNATGAPTVLPRPTIEMEFGGDEAVCTAACVPEGVELR 340
83722613 259 DAQRDGFSATSTLTSEARAGLAPPRNLTCEFTWHRDAVSFSRRNATGAPTVLPRPTIEMEFGGDEAVCTAACVPEGVALQ 338
9629425  399 WFLGDDPSPAAKSAVTAQESCDHPGLATVRSTLPISYDYSEYICRLTGYPAGIPVLEHHGSHQPPPRDPTERQVIEAIEW 478
9629314  368 WFLGDDSSPAEKVAVASQTSCGRPGTATIRSTLPVSYEQTEYICRLAGYPDGIPVLEHHGSHQPPPRDPTERQVIRAVEG 447
30984472 344 WLLGADPAPAEDAAASGGPCPGHPGLARVRSALPLSREHSEYTCRLVGYPPTVPVLEHHGRHEPAPRDPVGQQVTTALEW 423
56694767 341 WLLGADPAPAENAVVAGGPCPGRPGLARLRSALPLSREHSEYTCRLVGYPATVPVLEHHGRHEPPPRDPVGQQVTTALEW 420
83722613 339 WLLGADPAPAGNAVASGGPCPGRPGLARLRSALPLSREHSEYTCRLVGYPATVPVLEHHGRREPPPRDPVGQQVTTALEW 418
9629425  479 VGIGIGVLAAGVLVVTAIVYVVRTSQSRQRHRR 511
9629314  448 AGIGVAVLVAVVLAGTAVVYLTHASSVRYRRLR 480
30984472 424 AGIAAGSAAAIGLAVGVGVYVRRAVARRRRVRT 456
56694767 421 AGVAAGSAAAIGLAVGVGVCARRALERRRRVRA 453
83722613 419 AGIATGAVAAIGLAVGVGVCARRALERRRRGRA 451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap