Conserved Protein Domain Family
PHA03269

?
PHA03269: PHA03269 
envelope glycoprotein C; Provisional
Statistics
?
PSSM-Id: 165527
View PSSM: PHA03269
Aligned: 2 rows
Threshold Bit Score: 947.627
Threshold Setting Gi: 13242406
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9625889    1 MKRIQINLILTIACIQLSTESQPTPVSITELYtsaatRKPDPAVAPTSAASRKPDPAvaptsaasrkPDPAVAPTSAASR 80 
13242406   1 MPPFITIVLITLTYVNSIIANLNTNIPTPQLH-----QLSDPAPQSHQQSSTAPDPA----------PQLHQAPTPQAYE 65 
9625889   81 KPDPAVAPTSAATRKPDPavAPTSAASRKPDPAVAPTSAATRKPDPAVAPTSAASRKPDPAANTQHSQPPFLY----ENI 156
13242406  66 QFDPAPQSHQQSSTAPDP--APQLHQAPTPQAHEPFTSAPQAHEASVDTGVSTFSKTSTPAFHTQTTPQSTAYtrsmEHI 143
9625889  157 QCVHGGIQSIPYFHTFIMPCYMRLTTGQQAAFKQQQ--KTYEQYSLDPEGSnitrWKSLIRPDLHIEVWFTRHliDPHRQ 234
13242406 144 ACTVIGRRFLPYFHKVSLPCYLQIFTGYGAYVKRHElpTVYREDFQHPNRA----WKPLLRPDLHVEIWFKKY--DSKTS 217
9625889  235 LGNALIRMPDLPVMLYSNSADLNLINNPEIFTHakENYVIPDVKTTSDFSVTILSMDATTEGTYIWRVVNTKTKNVISEH 314
13242406 218 DLNFNVQNSNSPLILLYSNIINTTSMNPDLSNT--EKYILPDRNTTYDFTLHIVSLDVSTEGTYIWRVIHTANNTVINEQ 295
9625889  315 SITVTTYYRPNITVVGDPVLTGQTYAAYCNVSKYYPPHSVRVRWTSRFGNIGKNFITDAIQEYANGLFSYVSAVRIPQQK 394
13242406 296 HVTVMSYKRPNVTVISDSVLLGNPYTAYCKVNNYYPPNSVIVKWTSNLGNVRNNFITYSKKYNTDGLVSSVSTLHVPATL 375
9625889  395 QMDYpPPAIQCNVLWIRDGVSNMKYSAVVTPDVYPFPNVSIGIIDGHIVCTAKCVPRGVVHFVWWVNDSPINHENSEITG 474
13242406 376 NADY-PPSLRCNVLWIRDSVSHTKYSSAVTPDVYYKPNVSIEVIDGRIVCLASCVPRGVVRINWWINDIPVENTNTEILS 454
9625889  475 VCDQNKRFVNMQSSCPTSELDGPITYSCHLDGYPKKFPPFSAVYTYDASTYATTFSVVAVIIGVISILGTLGLIAVIATL 554
13242406 455 VCNNNRRFVNLRSYHDVSGTDGPMVYSCKLVGYPKKFPPFVAVYTYDASSSASTFPLISAIIGIVTIIVILLTIVLLCVL 534
9625889  555 CIRCCS 560
13242406 535 CRYCCK 540
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap