Conserved Protein Domain Family
PHA03265

?
PHA03265: PHA03265 
envelope glycoprotein D; Provisional
Statistics
?
PSSM-Id: 165523
View PSSM: PHA03265
Aligned: 3 rows
Threshold Bit Score: 861.671
Threshold Setting Gi: 9629802
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629802     1 MSTFKPMMNGCLVFAAIITLLSFMLSLGTCENYRRVVRGNQNQRPEFPPPRYNFTIVTTYNETSLPSPFINDQVKIVDVR 80 
126801894   1 MSTFKLMMDGRLVFAMAIAILSVVLSCGTCEKAKRAVRGRQDRPKEFPPPRYNYTILTRYNATALASPFINDQVKNVDLR 80 
216905925   1 MSTFKLMMDGRLVFAMAIAILSVVLSCGTCEKAKRAVRGRQDRPKEFPPPRYNYTILKRYNATALASPFINDQVKNVDLR 80 
9629802    81 TVAATRPCEMIALIAKTNVDSIIKELDAAHKTYSARLTWFKITPTCATPIHDVVYMKCNPKLLFGMCDERSNILWLNSLI 160
126801894  81 IVTATRPCEMIALIAKTNIDSILKELAAAQKTYSARLTWFKIMPTCATPIHDVSYMKCNPKLSFAMCDERSDILWQASLI 160
216905925  81 IVTATRPCEMIALIAKTNIDSILKELAAAQKTYSARLTWFKIMPTCATPIHDVSYMKCNPKLSFAMCDERSDILWQASLI 160
9629802   161 TTAAETDDELGLVLASPAHSYSGLYRRVIQIDGRRIYTDFSVTIPSSHCPLSFEQNFGNPDRCKTPEQYSRGEVYTSRFL 240
126801894 161 TMAAETDDELGLVLAAPAHSASGLYRRVIEIDGRRIYTDFSVTIPSERCPIAFEQNFGNPDRCKTPEQYSRGEVFTRRFL 240
216905925 161 TMAAETDDELGLVIAAPAHSASGLYRRVIEIDGRRIYTDFSVTIPSERCPIAFEQNFGNPDRCKTPEQYSRGEVFTRQFL 240
9629802   241 SEFNYRQGVHLAWVKHWFVQDGGNLPVQFYEAQAFARPVPPDNHPGFDSVESEITQNKTNPKQEQASPKPNPPFKWPSIK 320
126801894 241 GEFNFPQGEHMTWLKFWFVYDGGNLPVQFYEAQAFARPVPPDNHPGFDSVESEITQNKTDPKPGQADPKPNQPFKWPSIK 320
216905925 241 GEFNFPQGEHLTWLKFWFVYDGGNLPVQFYEAQAFARPVPPDNHPGFDSVESEITQNKTDPKPGQTDTKPNQPFKWPSIK 320
9629802   321 QLAPRIDEVDNAKEITTKKPPASNSNSTFIGVVIGLGVVGLISVGAILYVCWRRRKSQNKSGKNGSPSLRSTFKDVKYTQ 400
126801894 321 HLAPRLDEVDEVIEPVTKPPKTSKSNSTFVGISVGLGIAGLVLVGVILYVCLRRKKELKKSAQNGLTRLRSTFKDVKYTQ 400
216905925 321 HLAPRLDDLDKVIEPTTKPPQTSKGNSTFVGISVSLGIAGIVLVGVILYVCLRRKKELKKSAQNGLTRLRSTFKDVKYTQ 400
9629802   401 LP 402
126801894 401 LP 402
216905925 401 LP 402
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap