Conserved Protein Domain Family
PHA03260

?
PHA03260: PHA03260 
Capsid triplex subunit 2; Provisional
Statistics
?
PSSM-Id: 165518
View PSSM: PHA03260
Aligned: 2 rows
Threshold Bit Score: 557.811
Threshold Setting Gi: 109638526
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
109638639   1 MNLFGRTSDNWIAMQSTRPGEFYAPPLgekmiEDVP------MGIFVRVVGRNDEGHKLFHPSFHGEkrnvvnahfPAPH 74 
109638526   3 TGFTSLMVEGWRTAQTLHGAPHKAPPL-----EHLPprivasTGTFVRLMATYGEKAPRYVPTVHGE---------PVHL 68 
109638639  75 LGPKEYVAFVTRSLATDLSASLTLAH----QQQTVVNTSKTPM-RCGDIFVVSAPDCDDMAAQQKHvwlndSLASAGGSA 149
109638526  69 DSTRDRYALVQDDNNGSYTNGMIHVEctpmKQYMVVHTGADPLiPVESCFYVSPPSDRDREQQRKC-----ANSPRTRSS 143
109638639 150 MHNSMVKLAGGLLATQVIPPNAVDDLSHKVSRDIDYLSALDTTAAHTVPCPALQFGMQTLYSAFQMhNIFVDGNAQptta 229
109638526 144 INPLSIPLLGGLYATRKLAADAVDVVGHRMKRDLDLFNTNPQEALSTVGDDAVRLALHQLYTAQKL-AVHIQGAHQ---- 218
109638639 230 aAIIKKYADYVEGKNPNPPTLSEMKGLIANDKMKMLMCDGMAAMVDYYKLIVQDTCGVVLSSFFNNPTSIHGEAVYGPTC 309
109638526 219 -SVIAAYTEFVEGVRAEPPSLDGVRMLMGDATLRTLMCDGVDHMVSYYNTYKSTTMGTVLSSRFVPTPCVAGQLMVNQQM 297
109638639 310 GHYTPMSAVIAFMFKYNGI 328
109638526 298 GRVDCGSAFWAFITTFNGV 316
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap