Conserved Protein Domain Family
PHA03259

?
PHA03259: PHA03259 
Capsid triplex subunit 2; Provisional
Statistics
?
PSSM-Id: 165517
View PSSM: PHA03259
Aligned: 10 rows
Threshold Bit Score: 503.111
Threshold Setting Gi: 51874280
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
61660196    1 METTVLVTFEQRLTTGDVGKLSRLIGAVIPIPYRHHLLGSSQVGLDAVVkDKTRDYSRMRARMREMTLTIMRRVEGNQMI 80 
51556576    1 MDSTIFCTFEQKLSLTDVGKLAKLTGAIIPIPQRHHLIKHHHLGLHQYI-DSTRGYARLRSLLRNMTPTILRRIEGNQLA 79 
51874280    1 -MDSIYCTFDQKLTLSDIGTLCKLTNAVIPIPSHRHLIGNTNLGLYTVL-STTTDYIQIRDILKTMVLTILQKVEGNQLI 78 
52139258    4 MEANIFCTFDHKLSIADVGKLTKLVAAVVPIPQRLHLIKHYQLGLHQFV-DHTRGYVRLRGLLRNMTLTLMRRVEGNQIL 82 
20026676    4 MESTIFCTFDHKLTIADLGKLAKLTAAVVPIPQRLHLIKHLQLGLHQYT-DHTRGYPRMRSLLRNMTLTLLRRVEGNQIL 82 
9633127     1 -METVYCTFDHKLSLSDISTLCKLMNIVIPIPAHHHLIGSGNLGLYPIV-SSNKDYVHIRNVLRTMVVTILQKVEGNQLV 78 
9628358     1 -METVYCTFDHKLSLSDISTLCKLMNIVIPIPAHHHLIGSGNLGLYPIV-SSNKDYVHVRNVLRTMVVTILQKVEGNQLV 78 
9845370     1 METTVLCTFEQRLTAGDVSKLAKMIGAIVPIPSRHHLIGSAQVGLNAIInDKQRDYARVRTRMRDMTYTVMRQVEGNQMV 80 
14251072    4 PDTTVFCTFEQKLTAGDLGRLSKYIGAVVPIPFRHHLIGHTAIGLHRLL-DERRAYARLRTLLRDMTLTIVRRLEGNQML 82 
213159220   1 METTTFCTFEQKLSPSDMGKLARVIGAVIPIPQREHLISHSHIGLYKTI-KSHRDFYKIRTTLRNMTLTVLRQVEGGQIL 79 
61660196   81 LGVPTHGQCYTIRNTGPVSWEKGDVLTTLPPVFSGEVT--GLVSVSDWDLVLPWIVPMALATEINQRMMMLALLSLDRSH 158
51556576   80 MQVPTHGHLYTVLNTGPVLWEKGDALCQLPPLFSGPLVreHPVSVGNWNLVLPWLLPAPLAVEINQRILIMALYSLDRSY 159
51874280   79 LIRPKIGHQYEIKNTGPFPLEKGDQLSLLPPFLKPSQ---QLLVLPNWELILPLLIPTDVATEINVRMLCISLLSIHRKY 155
52139258   83 LHVPTHGLLYTVLNTGPVTWEKGDALCVLPPLFHGPLAreNLLTLGQWELVLPWIVPMPLALEINQRLLIMGLFSLDRSY 162
20026676   83 LHVPTHGLLYTVLNTGPVLWEKGDALCLLPPLFNGPMAreNLLTLGKWELVLPWVIPVPLAQEINQRLLIMGLFSLDRSY 162
9633127    79 LRKPMTGQQYAIKNTGPFPWEKGDTLTLIPPLSTHSEE--KLLKLGDWELTVPLVVPTAIAAEINIRLLCIGLIAVHREY 156
9628358    79 LRKPVTGHQYAIKNTGPFPWEKGDTLTLIPPLSTHSEE--KLLKLGDWELTVPLVVPTAIAAEINIRLLCIGLIAVHREY 156
9845370    81 LGILEYGRVYTVKNTGPALWEKGDVLTALAPVFSTESA--ALVTVGNWQLVLPWIVPLPLATEINQRLLLIALLSLDRSR 158
14251072   83 LGIPVHGHCYTVQNTGPVLWEKGDQLVLCAPLLPPDPE--RAVRIGGWSLVLPWIIPQPLAMEINQRLLVIALLSLERPY 160
213159220  80 LGVPVHGRLYTIRNTGPVQWEKGDTLVVYPPVTTTLQQn-SIMSLPEWELVVPWIIPSSLAAEINQKLTVMGLLSLDRNY 158
61660196  159 EEVRAATAQLRVVRYRDATLTLPEITIDDTVLIDMRNVCISLSMIANLSSEVTLAYVRKLALEDSNMLLMKCQEILGRRM 238
51556576  160 EEVKAAVNQLQHVTFRDATFTIPDPVIENHLLLDMKTACLSMSMVANLASDLTVNYVRKLALEDSSMLLTKCQELLMRLN 239
51874280  156 EEVQIIIDELRTLQYRDVTIKLPDVINDCKSTFSMKTACISFSMIATMAPDIVQTYIERLSLEDQSMLLIKCQELLAKKN 235
52139258  163 EEVKAAVQQLQTITFRDATFTIPDPVIDQHLLIDMKTACLSMSMVANLASELTMTYVRKLALEDSSMLLVKCQELLMRLD 242
20026676  163 EEVKAAVHQLKTITYRDATFTLPDPVIDNYLLLDMKTACLSMSMVANLASDLIVTYVRKLALEDSSMLLVKCQELLTRTD 242
9633127   157 NEMQTIIDELCSIQYRDVLIKLPDIVNDKQSMYSMKTACISLSMITAMAPDIVRTYIDRLTLEDHSMLLIKCQELLSKRT 236
9628358   157 NEMQTIIDELCSIQYRDVLIKLPDIVNDKQSMYSMKTACISLSMITAMAPDIVRTYIDRLTLEDHSMLLIKCQELLSKRT 236
9845370   159 EEVRAASAQLRTVRYRDATILLPELSLNDTTLVDLRNVCISLSMIANLASEVVMTYVRKLALEDSSMLLMKCQEILTRQD 238
14251072  161 EQVRAATAQLRTIHYRDATFSLPDVQLDEPLLDELKTVCLSMSMVTNLASELVQTYVRRLALEDHSMLLLKCQELLARRT 240
213159220 159 EDARAAIARLRQIQFRGTTFTLPDVVNDDNTLWDMKNICISMSMIANLATDLTLGYVRKLALEDRSMLLTKCQELLVRRV 238
61660196  239 PQVGVGAGSsgdrnDPPARSrtnyNITPTEELNKLTALFVMIRQITDVISEQPAFLVCDVSPDDKSALCIYKG 311
51556576  240 RDDDGTGGNnsnrlLRGRPS----HVSPDEEISRLSALFVMLRQLDDIIHEQVMFTVCDVSPDNKSATCIFKG 308
51874280  236 FSQEPSSFK---------------ATEIKTELQKIKTVFTMINQINSLTQEKTFFIVADVSADNRLATCIFKE 293
52139258  243 RERSVGEPR-----TPARPQ----HVSPDDEIARLSALFVMLRQLDDLIREQVVFTVCDVSPDNKSATCIFKG 306
20026676  243 RERGGER-------VPPRPN----HVSPDEEISRLSALFVMLRQLDDLIREQTIFTVCDVSPDNKSATCIFKG 304
9633127   237 T-------------LSTQRCgqlhATDIKDELKKIKSVLTMIDQINSLTNEKTYFVVCDVSADNRMATCIYKN 296
9628358   237 T-------------LNTQRCgqlhATEIKDELKKVKSVLTMIDQINSLTNEKTYFVVCDVSADNRMATCIYKN 296
9845370   239 LPRGGGNAGhgdslAARGRNp---NMTPTEELNKLTALLVMIRQISDIVAEQPLFVVCDISPDDKSAVCIFKG 308
14251072  241 AAAGGRRED-----DAAAAAaaveHLDPRDEVAKLTAFFVMVRQLVDVVTEQPVFQVCDVAPDNKSATCLFKG 308
213159220 239 GDHHRPGEN-----NPGRRGq---LLAPEDEAAKMSTFLVMVRQVLELVMEEPAFIVCDVTPDNKSATCIFKG 303
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap