Conserved Protein Domain Family
PHA03258

?
PHA03258: PHA03258 
Capsid triplex subunit 2; Provisional
Statistics
?
PSSM-Id: 165516
View PSSM: PHA03258
Aligned: 13 rows
Threshold Bit Score: 502.29
Threshold Setting Gi: 9629569
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
10140948    1 MAVDSKIVVSCTSRLFTDEVCKLQEKVGCIVPLRDSHGSQNLQTVGLKPALGIDLGSDYVLMCNYLSTCTLAILEEVTTD 80 
13095603    1 MLQDRSIVISLTSRLFTDEISSLQEKIGCVLTVQDSHRLQNIQSLGLGQVFPKDAFPDYVQMYYYITNATLAILEEVKPD 80 
9625982     1 MLTDKTIIVSLTSRLFADEITKLQKKIGSILPLQDPHKLQSLDTLGLNAVCSRDVFPDYVHMFSYLSKCTLAILEEVNPD 80 
9628028     1 MQVDSRIVVTLTSRLYADEISKLQERVGSVVPLKDSHRLQNLNSVGMYSVYMRNVAPDFVAMFSYLSEATLAILDEVTPD 80 
9629569     1 MASNRNIVITLTSRLYADEISALQEMVGAVICLQHYHQVQDVTSIGLGHIIRPEGPVDWIAAFHYLRRCTFGILHEINPD 80 
9631216     1 MLTDKTITVSLTSRLFADEIAKMQKKLGSILPLQSPHKIQSLETLGLNTVCSRDVFPDYVHMFSYLSKCTLAILEEVNPD 80 
18653832    1 MALDKSIVVSVTSRLFADEIANLQSKIGCILPLRDAHRLQNIQALGLGNLCSRDSAVDFIQAYHYLDKCTLAVLEEVGPN 80 
24943109    1 --MDLKVIVSLSSRLYTDEIAHLQERLGCILPLAHCHGTQNIASVGLGSVYSAETVPDYVAMYNYLSNCTLAILDEVNVD 78 
51518065    1 --MDLKVVVSLSSRLYTDEIAKLQQRIGCVLPLASTHGTQNVQGLGLGQVYSLETVPDYVSMYNYLSDCTLAVLDEVSVD 78 
83642863    1 MFVDSKVVVSCTSRLFTDEVCKLQEKVGCIVPLQDSHGAQNLQTVGLKPALGVDLSSDYVLMANYLSKCTLAILEEVSAD 80 
82503252    1 --MDLKVVVSLSSRLYTDEIAKMQQRIGCILPLASTHGTQNVQGLGLGQVYSLETVPDYVSMYNYLSDCTLAVLDEVSVD 78 
139424527   1 --MDLKVVVSLSSRLYTDEIAKMQQRIGCILPLASTHGTQNVQGLGLGQVYSLETVPDYVSMYNYLSDCTLAVLDEVSVD 78 
139472871   1 MALDKSIVVNFTSRLFADELAALQSKIGSVLPLGDCHRLQNIQALGLGCVCSRETSPDYIQIMQYLSKCTLAVLEEVRPD 80 
10140948   81 SLVLTKISRNGTYQIKNKYHPFFQWDSNIQVCVMPPLFDQESNSVDLQSNNFTLLLPIVVPCEVAHEALQKVLTYNIYLR 160
13095603   81 SIVLTRIDPNITYQIKNSYRPFFQWDSHSQLCVIPPIFGRDVSTVSLESNGVDIVFPVVVPERLANIVLQKLLLYNIYSK 160
9625982    81 NLILTRLDPSETYQIKNVYEPMFQWDGFSNLTVIPPVFGRQQATVTLESNGFDLVFPSVVPSDLAQAIIGKLLLYNLYSR 160
9628028    81 TLVFSRLDHSQNYELKNVYYPSFAWHSHTLLTVVPPVFGREAATVALESNGFEIVFPVVMPHALAQAVLQKLMLYNIYAR 160
9629569    81 SISIIRVDPGENYQIKNTSKPYVMWDEHDDLAIIPPIFGVQQCTIKLDSNDVNLVFPSVVPAGLAQMGIQKILMYNLYSN 160
9631216    81 RLILTRLDPSEIYQIKNVYEPLFQWDGFTNLTVIPPVFGRQKATVTLESNGFDLVFPSVVPSDLAQAIIGKLLLYNLYSR 160
18653832   81 SLRLTRIDPMDNYQIKNAYQPAFHWDNYSELVVIPPVFGRKDATVSLESNGFDVVFPAVVPEPLAQTVLQKLLLYNIYYR 160
24943109   79 SLVLTKMIPGQTYALKNQYHPFFQWHGPGTLSVMPPVFGREQATVRLQSNDSDIIFPMVVPKQVGDEILQKILLYTVYSR 158
51518065   79 SLMLTKIVPGQTYAIKNKYQPFFQWHGTGSLSVMPPVFGREHATIKLESNDVDIVFPMVLPTPIAEEVLQKILLFNVYSR 158
83642863   81 TLTLTKITRTGTYQIKNKYTPFFQWDSNTQVCVIPPILDQPGNSVELESNNFTLLLPMVVPCEVAHEVLQRVLTYNIYLR 160
82503252   79 SLILTKIVPGQTYAIKNKYQPFFQWHGTGSLSVMPPVFGREHATVKLESNDVDIVFPMVLPTPIAEEVLQKILLFNVYSR 158
139424527  79 SLILTKIVPGQTYAIKNKYQPFFQWHGTGSLSVMPPVFGREHATVKLESNDVDIVFPMVLPTPIAEEVLQKILLFNVYSR 158
139472871  81 SLRLTRMDPSDNLQIKNVYAPFFQWDSNTQLAVLPPFFSRKDSTIVLESNGFDLVFPMVVPQQLGHAILQQLLVYHIYSK 160
10140948  161 VTQAEPNAARMADVLAQTNYVTYLGNHYSLNLEGMESLGALAFLDNLATYLCIMVGLLPRACVRLLTTLLRHGENELLNV 240
13095603  161 LSQETPNEVNMAEVSLYTTNISYLGRNYVLAIENMNPSSSMALLDDLAIYVSILSALLPKACIRLITTLMRHGQHELLDV 240
9625982   161 LVESDP-EINIEEVNMYTTNVTHMGRHYVLDINHNNPNEALKSLDDLAVYTCILSALIPRACLRVLTILMRHDQHELLDV 239
9628028   161 LSDANVGDVNMDHVRFHATTLHHMGRAYTLHIDQANPGGMLGLLDNLAIYLAIISALLPNSLARLLPAIMRHEQHELLNI 240
9629569   161 LLAAERNHDNVNALEHYTRNISYMGRTYNLDAMAQHQDGAMAVLDDVAMCTAVLAAIVPEVCNRVAMATIREGQHPLVEV 240
9631216   161 LVESDP-EINMEEVTMYTTNVTHMGRHYVLDITHNNPNEALKSLDELAVYTSILSALIPRACLRMLTILMRHEQHELLDV 239
18653832  161 VAETTPTDVNLAEVTLYTTNITYMGRNYALDVDPVGSSSAMRMLDDLSIYLCVLSALIPRGCVRLLTSLVRHNKHELVEI 240
24943109  159 VAAQEPNTVDFTEVNLHFGSISYLGRHYDLTLPEIPGTLGLALMDNLSLYLSVLTALIPRACLRFFRGLVRHEHHELLNL 238
51518065  159 VVMQAPGDADMLEVRMHLGSVSYLGHHYELALPEVPGPLGLALLDNLSLYFCIMVTLLPRASMRLVRSLIRHEHHDLLNL 238
83642863  161 VTQAEPDAARMADVLARTNYVTYMGHHYPLNLENLENSGALAFLDNLALYLCIMVGLLPRSCVRLLTTLLRHGENELLHV 240
82503252  159 VVMQAPGNADMLDVHMHLGSVSYLGHHYELALPEVPGPLGLALLDNLSLYFCIMVTLLPRASMRLVRGLIRHEHHDLLNL 238
139424527 159 VVMQAPGNADMLDVHMHLGSVSYLGHHYELALPEVPGPLGLALLDNLSLYFCIMVTLLPRASMRLVRGLIRHEHYDLLNL 238
139472871 161 ISAGAPDDVNMAELDLYTTNVSFMGRTYRLDVDNTDPRTALRVLDDLSMYLCILSALVPRGCLRLLTALVRHDRHPLTEV 240
10140948  241 FRRMIPDEFNaaAANLNADTVYPDMTKIGLLITYLQTLGSIFNLSPRLQVSTYTPENLSATCWYVC 306
13095603  241 FGGLVPPEIH--NIDLNNMNIGDDMTRMGAFITYIQTLGSVFNLGSRLHLSTYSSDTNTATCWISS 304
9625982   240 FRGIVPREVY--EIDANALSIGDDITRMTTFITYLQSLSSIFNLGAKLHLSSYASETQTATCWISY 303
9628028   241 FAGVAPPD------DGGDFNIEDDMQKMESFMAYMQSVSSIFNLGPKLRLGQYSSETQSGTAWLAS 300
9629569   241 FADNVPM-----LQRGQELNVEQDIMLMGLFMAYTHKLGSIFNLSTRLCLGAYSHETKIGTCWL-- 299
9631216   240 FRGIVPREVY--EIDASALNIGDDITRMSTFITYLQSLSSIFNLGVKLRLLSYTSEALTATCWISH 303
18653832  241 FEGVVPPEVQ--ALDLNNVSVADDITRMGALITYLRSLSSIFNLGRRFHVYAFSSDTNTASCWCAY 304
24943109  239 FQGMVPDEVT--RLDLNALSAGDDLTRMRVFMSYLQSLASLFNLGPLLFMSVYSPETLVATCWLH- 301
51518065  239 FQDMVPDEIA--RIDLDALSVADDLSRMRVMMTYLQSLASLFNLGPRLATAAYSQETLTATCWLR- 301
83642863  241 FRRIVPEEFN--AADLNADTVYPDMTKIGMLMTYLQTLGSIFNLGPRLQVSLYTPENLAATCWYSS 304
82503252  239 FQEMVPDEIA--RIDLDDLSVADDLSRMRVMMTYLQSLASLFNLGPRLATAAYSQETLTATCWLR- 301
139424527 239 FQEMVPDEIA--RIDLDDLSVADDLSRMRVMMTYLQSLASLFNLGPRLATAAYSQETLTATCWLR- 301
139472871 241 FEGVVPDEVT--RIDLDQLSVPDDITRMRVMFSYLQSLSSIFNLGPRLHVYAYSAETLAASCWYSP 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap