Conserved Protein Domain Family
PHA03257

?
PHA03257: PHA03257 
Capsid triplex subunit 2; Provisional
Statistics
?
PSSM-Id: 177569
View PSSM: PHA03257
Aligned: 20 rows
Threshold Bit Score: 444.076
Threshold Setting Gi: 51557523
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
255683196   1 MTTEQFIVEIIIPSGISHADTSALQKCEGRIIFLSSVRRRIALSDIDYKSFYTNGTEPDTLALLAAFRRRFAAVITRIMP 80 
125745069   2 STSNGTIVEIELPCKLSTCDANLLQRCEGRVLFLPFVRARVLLKDVDYKSFYIAGTEPDTLSLLSTFKTRFAAVITRALP 81 
83722586    1 MLTDGFESEIAIPSGISRADAAALQRCEGRVVFLPTIRRQLALADVAHESFVAGGQAPDTLGLLLAYRRRFPAVIARALP 80 
57790973    1 MTSGQYEIRVVLPNGLTRDEEDRLRSLRGTILMAPILRRCVFLHEIDQKSFFAHGKEPDYATLLTAYRRRFPILIVCVEN 80 
56694740    1 -MTDGFESEIAIPSGISRADAAALQRCEGRVVFLPTIRRQLALADVAHESFVAGGQAPDTLGLLLAYRRRFPAVIARALP 79 
9629398     1 MLADGFETDIAIPSGISRPDAAALQRCEGRVVFLPTIRRQLTLADVAHESFVSGGVSPDTLGLLLAYRRRFPAVITRVLP 80 
9629287     1 MITDCFEADIAIPSGISRPDAAALQRCEGRVVFLPTIRRQLALADVAHESFVSGGVSPDTLGLLLAYRRRFPAVITRVLP 80 
10834887    2 AASNGTTVEIELPCGLSTCDANLLQRCEGRVLFLPSVRARVLLKEVDYKSYYIAGAEPDTLSLLSTYKRRFAAVVTRALP 81 
12084846    2 ASFNGTTVEIELPCRLSTCDANLLKKCEGRILFLPTVRSRLSLTDVDYKSFYVAGTEPDTLNLLSIFKTRFAAVITRVLP 81 
30984446    1 MLTDGFESEIAIPSGISRADAAALQRCEGRVVFLPTIRRQLALADVAHESFATGGVAPDTLGLLLAYRRRFPAVIARVLP 80 
255683196  81 GKITAVVLGIGPLISGLS-LQNTSPFDLINGDSVCFLPPMLGGGigdGRLKLDSISTELIFPMTIPGSIAREIISKVVAL 159
125745069  82 GRMSAVVLGMGSIPNGLA-LQNTGPFDLCNGDTVCLMPPIFPNVc--CRIRLESIDTELLFPVTVPTRLANEILAKTLSR 158
83722586   81 TRLVAYPLDLGLTHAGTAsLRNTAPVDLCNGDPVSLVPPVFEGPs--TDLRLESLDLTLRFPVTLPAALAREIVARLVAR 158
57790973   81 RELSAIALSIG-YPRGIS-VRNTGPFSLNNGDLVSLLPPITNTR---FRVDLPSCGSVIEPAMTIPFEIGTELMGKIFAG 155
56694740   80 TRLVAYPLDLGLTHAGTAsLRNTAPVDLCNGDPVSLVPPVFEGPs--TDLRLESLDLTLRFPVTLPSALAREIVARLVAR 157
9629398    81 TRIVACPLDVGLTHAGTVnLRNTSPVDLCNGDPISLVPPVFEGQa--TDVRLDSLDLTLRFPVPLPSPLAREIVARLVAR 158
9629287    81 TRIVACPVDLGLTHAGTVnLRNTSPVDLCNGDPVSLVPPVFEGQa--TDVRLESLDLTLRFPVPLPTPLAREIVARLVAR 158
10834887   82 GRMSAVVLGMGTIPSGLA-LQNTGPFDLCNGDAVCLIPPLFPNVc--SRIRLESIDTELLFPSTVPARLAREIIAKTLSR 158
12084846   82 GRLSTSVLGIGPIPCGLA-LQNTGPFDLCNGDAICFMPPVFPNIc--CRMRLESVDVDLLFPATVPSRLAREIFAKILSR 158
30984446   81 TRLVAYPLDLGLTHAGTAnLRNTAPVDLCNGDPVSLVPPVFEGPs--TDVRLESLDLTLRFPVTLPSSLAREIVARLVAR 158
255683196 160 SLGAVvqTAQIQPRGVQRDTIPIHYNGRRYNITPSIQNLDA-AESVARTLVLNMMFAISEGCMILFALIPHLLTLSGQDG 238
125745069 159 AIEAI--GRGQMPPPTSRESETIMYNGRSYTISPTLHSLDA-AESTVRTLLLNMIFAINEGNMILYTMIPTLLTLGASDG 235
83722586  159 GIRAL--NPDPRAPRELAELNAVYYNGARLPLVANVEQLAP-VNAEVRTLILNAAYSITEGTAVVLSLIPRLFALSAQDG 235
57790973  156 MAYDFc-VRNQIATTRPRDIYVVTYKNKTLDLSTLPPSDAAaLQDTMKSLFSSVLFSIHEGVMSVLSLMPALLAGGANDP 234
56694740  158 GIRAL--NPDPRAPRELADLNAVFYNGARLPLVANVEQLAA-VNAEVRTLILNAAYSITEGTAVVLSLIPRLFALSAQDG 234
9629398   159 GIRDL--NPSPRNPGGLPDLNVLYYNGSRLSLLADVQQLGP-VNAELRSLVLNMVYSITEGTTIILTLIPRLFALSAQDG 235
9629287   159 GIRDL--NPDPRTPGELPDLNVLYYNGARLSLVADVQQLAS-VNTELRSLVLNMVYSITEGTTLILTLIPRLLALSAQDG 235
10834887  159 ATEGIaiGGGLAPPPTSREAESITYNGKTYTISPTLHSLDA-SESAVRTLLLNMIFAIDEGNMLLYALIPTLLTLGASDG 237
12084846  159 AIETIa-SSAERNPPASRGPETVTYNGKSYTITPALQSLDA-AESAARTLLLNMLFAVTEGNMILYTMIPTLLTLGVSDG 236
30984446  159 GIRSL--NPDPRAPAELADLNAVYYNGARLPLVANVEQLEP-VNAEVRTLILNAAYSITEGTAVVLSLIPRLFALSAQDG 235
255683196 239 YVNALVQLQSAARAAGQLMNMPR-QiPQIQDGDRRFPIYETISWWLNMTTTLNESLRPREQVRVCVIEGP-PTIKPGNMA 316
125745069 236 YINALVGLETATRAVGQLIRIPN-P-PPLQDAWRRYPVYEALSAWITMTLNLGNVLSLHPLLKVCTFDGP-ANIKAGDLC 312
83722586  236 YVNTLLQMQSATREAAQLIHPEA-P-GPPQDGERRLPVYEALVAWLAHAAQLGDALALAPVARVCTFDGP-TVVRSGDLA 312
57790973  235 FLNAILQMQSMTRLSVQLFNPPAlElPEPAGSSGRYHVFDAFAAWLSMSHRLGDLFNLKPVLKVVMFYSDdSTADEGDLL 314
56694740  235 YVNTLLQMQSATREAAQLIHPEA-P-GPPQDGERRLPVYEALVAWLAHAAQLGDALALAPVARVCTFDGP-AVVRSGDLA 311
9629398   236 YVNALLQMQSVTREAAQLIHPEA-P-ALMQDGERRLPLYEALVAWLTHAGQLGDTLALAPVVRVCTFDGA-AVVRSGDMA 312
9629287   236 YVNALLQMQSVTREAAQLIHPEA-P-MLMQDGERRLPLYEALVAWLAHAGQLGDILALAPAVRVCTFDGA-AVVQSGDMA 312
10834887  238 YVNALVGLQTATRAVGQLIRIPR-P-PPLQDAWRRYPIYEALSSWITMALHLGDMLALRPLLKVCTFDGP-ASIKVGDLC 314
12084846  237 YINALIGLETATRAVGQLVRIPR-P-PALQDAWRKYPIYEALSSWINMATHLGDILSLRSLLRACTFDGP-SNVKVGDMC 313
30984446  236 YVNTLLQMQSATREAAQLIHPEA-P-GPPQDGDRRLPVYEALVAWLTHASQLGDALALAPVARVCTFDGP-AVVRSGDMA 312
255683196 317 PVIDNY 322
125745069 313 PVIANW 318
83722586  313 PVIRYR 318
57790973  315 NAIVP- 319
56694740  312 PVIRYH 317
9629398   313 PVIRYP 318
9629287   313 PVIRYP 318
10834887  315 PVISNW 320
12084846  314 PVISNW 319
30984446  313 PVIRYY 318
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap