Conserved Protein Domain Family
PHA03256

?
PHA03256: PHA03256 
BDLF3; Provisional
Statistics
?
PSSM-Id: 165514
View PSSM: PHA03256
Aligned: 2 rows
Threshold Bit Score: 147.568
Threshold Setting Gi: 82503281
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82503281   1 MSAPGCSERQDKKRGTIGEREFGELLSWDPTDLPRTVARVYVAVGGLFEQEVSEVQRLENICTLLDLAGVECQTKAD 77 
139424524  1 MSAPGCSERQDKKRVTIGETEFGQLLSWDPTDLPRTVARVYVAVGGLFEQEVSEVQRLENICTLLDLAGVECQTKAD 77 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap