Conserved Protein Domain Family
PHA03255

?
PHA03255: PHA03255 
BDLF3; Provisional
Statistics
?
PSSM-Id: 165513
View PSSM: PHA03255
Aligned: 3 rows
Threshold Bit Score: 167.003
Threshold Setting Gi: 51518063
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
82503250    1 MAHARDKAGAVMAMILICETSLIWTSSGSSTASAGNVTGTTAVttpspsasgpsTNQSTTLTTTSAPITTTAILSTNTTT 80 
51518063    1 MAITGGKAGAVLAVMLICETSLAWTSSTPAPANATGTSSAVAV-----------TNQTATQTTTTSPVTTTAGGGANTTL 69 
139424525   1 MAHARDKAGAVLAMILICETSLIWTSSGSSTASAGNVTGTTAVttpspsasgpsTNQSTTLTTTSAPITTTAILSTNTTT 80 
82503250   81 VTFTGTTVTPVPTTSNASTINV---TTKVTAQNITATEAGTGTSTGVT----------------------SNVTTRSSST 135
51518063   70 VTSTGTAAPAASTTSNGTTPTTgesTTNATAQTSANTSTGASTQPPTTgtnatsnattisttattqaatlSNNTTQATST 149
139424525  81 VTSTGTTVTPVPTTSNASTINV---TTKVTAQNITATEAGTGTSTGVT----------------------SNVTTRSSTT 135
82503250  136 TSATTRITNA-----------TTLAPTLSSKGTSNATKTTAELPTVPDERQPSLSYGLPLWTLVFVGLTFLMLILIFAAG 204
51518063  150 TNATTHAANAtsnvsteattsTTSTPEPSNVTANATEETTAELPTPPDEKQPSSLTGLPLWTLVFVGLTFLMLILIFAAG 229
139424525 136 TSATTRITNA-----------TTLAPTLSSKGTSNATKTTAELPTVPDERQPSLSYGLPLWTLVFVGLTFLMLILIFAAG 204
82503250  205 LMMSAKNKPLDEALLTNAVTRDPSLYKGLV 234
51518063  230 IMMATKNASLNEALLTSTAPRDPSLYKGFV 259
139424525 205 LMMSAKNKPLDEALLTNAVTRDPSLYKGLV 234
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap