Conserved Protein Domain Family
PHA03250

?
PHA03250: PHA03250 
UL35; Provisional
Statistics
?
PSSM-Id: 165509
View PSSM: PHA03250
Aligned: 7 rows
Threshold Bit Score: 734.63
Threshold Setting Gi: 9845326
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20026628    1 MSQQPGQPPPaagpsqaprpapgpsPTLPVLPVDDALNFRPDLFGDDHRRLLLDMLTQS-CSGFVGLLNHGLPSPTYLLE 79 
52139221    1 MAQGSRAPSG---------------PPLPVLPVDDWLNFRVDLFGDEHRRLLLEMLTQG-CSNFVGLLNFGVPSPVYALE 64 
51556519    1 ------MSLP---------------PSIPALPVDASLNLRPDLFSDEHRHLLVDILTQG-CGGYVGLLCYGLPMPSYVLE 58 
61660157    1 -MAAPTEEDP---------------RRDTSLMINERCNFPHNMLSEENINFIQDAVCNG-DLGAVAALNSGLPMAPYMLE 63 
9845326     1 MEEAPASDDP---------------RYRTSLFIDARHNFPERFLSPDDLDLILAALTDG-DAGVVAALNAGLPMAPYMFE 64 
14251023    1 --MAREEPAD---------------GQIPEIPIDEHLNLIPGLLSAENIAYFRDELVTVpCGDYLGAVNSGLPMTVYELE 63 
213159185   1 MSEGTSAQEP-----------------EPEIPLDENYNFSPSVLTEEDIRYVTHRLVEEpCLRNVAFFNSGIPVPAFELE 63 
20026628   80 SLVDFQIRNPYLRVKPVAQQIVKICILANHYRNSRDILVDLRTQLDVLYSGTLRTRILNGLLKLCrRARESGVTPEEISV 159
52139221   65 ALVDFQVRNAFMKVKPVAQEIIRICILANHYRNSRDVLRDLRTQLDVLYSEPLKTRLLRGLIRLC-RAAQTGVKPEDISV 143
51556519   59 TLIDFQIKTIYTKIKQIANSVIRICILANYLKNSQDLLVDLQANLDEINSGANKQRLYRGLHRIC-RQTNMMDVYRNMSQ 137
61660157   64 ALLAVRVKHRLTKVRQTLEPVICYTISVAHLINGTRILRSATAKHATAWGPNDKHRAESGLRRIY-RALNLEDNPFDLVE 142
9845326    65 ALCNPRVRHRFVKVRQLLEPVISFAVGAAHYYNGKRVLEEATNRRARMFGPPDIQRLDIGLRRIY-RAARSDDNPYDLME 143
14251023   64 SLLHVQIRAQNTKCRTVMETLVRLTVTINHYYNSRRIL-ELGVARVRQLGETNLDRLDAGYRRLH-RALEGSDNPYHLVE 141
213159185  64 ANIRVDVKRQCLRISQVAEQAVKIAVCASHLVNSKLLLVKYTDAITIFMNSPHRERLETGYRRLC-QALNDDSNPADMIQ 142
20026628  160 HLGADDVTYGVLKQVLGKLHRIRDALGLRPTPEAEV-RYSTLTAYNLLYLPPPFTTQEAVEVFAENLSNVTQR-NNRPMR 237
52139221  144 HLGADDVTFGVLKRALVRLHRVRDALGLRASPEAEA-RYPRLTTYNLLFHPPPFTTVEAVDLCAENLSDVTQR-RNRPLR 221
51556519  138 LLDAGDVTMGVYRQGLTQMRALTEALDLNREPNLQP-LYETLTSYNLLYIPPPYLSATAVEIYSENLSDLTKR-INRSFN 215
61660157  143 AVGDLDLSQGAYEGYVRHIYSLMKSLGHDVGHLSRSlDYSTMTVFNYLYESPLFTSQEAVTMYSRNLAGITKM-SREPFE 221
9845326   144 AVEDLDLPKGAYEKHLRTLYDLLQRVNVDLAATSGL-DYQRLSTFNYLFDAPRFLTQEAIETYADNLADITRRdATRPLR 222
14251023  142 DLTNTHLPLSRCQTHLHTLYRMCRQSRIETPEHLRD-EYPVLGLFNHLYLAPLLTNREGIDLYAANLADLTQQrTQPPLR 220
213159185 143 SLDDTYLPTSIYKHRLQHLYDLADSINIDVEDEARR-HYHKLGVFNNFYKSPLFFTTEAVLAYATNIEQITRG-NTLDFD 220
20026628  238 CMASIKRpgTRSHEDALNDLYFLVSARHLQLRHTLELQMMRLWVLEKCNRLCDDLYFCYTQVPETRQILVTLIRGLQLSR 317
52139221  222 CLTSIKRpgSRTLEDALNDMYLLLTLRHLQLRHALELQMMQDWVVERCNRLCDALYFCYTQAPETRQTFVTLVRGLELAR 301
51556519  216 LQTQINR--SKRADYVVNDVLFLLSARHLQFRHRLELQILETWIVNKCNYLCNDLYFAYVQVPECRGTFCNFVSGLQVVR 293
61660157  222 TLSVVHR--SKEPPEILNDMLFLLSVGRMIVLHQESLRALRKNLILTASALCSILYTAYTQVPETKSLFREVAHEAHALL 299
9845326   223 SLTVFKR--SKDVEDVANDIMFSLALGNAIVQQQAALIAMRKSLLLKLSRLCELSYVAYTQVPETKAVFADLARETHRLV 300
14251023  221 LWTAVQR--TRDPEPVLNDLMFLLSLNATLARHREELRALRKWIVMQLSVFCSDLYLVYTQVPETRDTYRRLAREVLGFI 298
213159185 221 LMTIKKL--SKDPIDVLNDMMFILSFNHMVFVQTEDCFTLRKWIITSLNNFTLDMHTAYTQVPETRITFLNLVDMVASMI 298
20026628  318 QSTS--------PAFRPVLYNLLQMLTQLHEAGVYLCPGYLHHAAYQLLEKIQRISDGRGgEDEDEDDEEDGEEGRrhrd 389
52139221  302 QHSS--------PAFQPMLYNLLQLLTQLHEANVYLCPGYLHFSAYKLLKKIQSVSDARErGEFGDEDEEQENDGEprea 373
51556519  294 KERH--------PTFRPLLHNLCSLLNTFHEANVYLCPQYLHSAIFLLLRRVSRVREG----DSSDSDSENQEAAEdrdt 361
61660157  300 SSRSpd-----tPNFRPFVACMLQFIKQIIAADVYTCPRYLTNQILAVTARMHGLEGA---AMGHDDDLD---------- 361
9845326   301 TSTSee-----pPDFGPPVATLLRFVRALMDADVYVCPEYVTGQIFAINSRMYDLDSA---LAGYDHELE---------- 362
14251023  299 DRFRpes--tedFLFAPVLALLFDFARQVQDADVYASPAFMRFASIIMIIRLYNAERGTRvTSGLDPDSEEEPGAG---- 372
213159185 299 NTNTdiedddedSQFKPALRVVFNMLRELEKASVYVLPGFMRFASFVVLLKLLNRRTETH-CAGLDLAFRGQEST----- 372
20026628  390 prtlpreisldLESDPTAVQGETFFLSKNLYGNPDIFRVPDHPSRYLRRRmFVHRQDIPQIFYNIHNGEITTEIYNLRRI 469
52139221  374 --------qldLEADPTAREGELFFFSKNLYGNGEVFRVPEQPSRYLRRRmFVERPETLQIFYNFHEGKITTETYHLQRI 445
51556519  362 llrrfregdldLEVDPTSTPLQNFYFAKNPFGNSEIFRIPEQASRYLRRNaWIDRSNLTYISYKLHNGTLSEESFPMRNL 441
61660157  362 -----------IEVDPGNPYS-AKYRMNNPYNDQNIFKCPRSLVHYVGDA-LFKKTMTQELLVSCTDQEATYQTYELPSV 428
9845326   363 -----------IEGDPSGPYDQIRYYAINPYTDSRLFKCPKDLLGHLGDG-LIRTRMVQSLITEATDTAVTYDNYELDAV 430
14251023  373 -----------LEEESISSFMEARYLARNPYGSRDLFRCPRDLVGFLGRG-FIRTTPTQEIMTGATEETVEFEHFQLDSQ 440
213159185 373 -----------ADLDPSTPYSVVEYNLKNPYGNKNLFRCPRNVPKHLGED-LVEMNMTQPIISTAEDGSPTVDYYELQKQ 440
20026628  470 YSMMIEGAARQTGLTPKRFLEIM-------DRAPLGQEPEPELADGYDLFADVERRPMVVtssstssaasssavastssa 542
52139221  446 YSMMIEGASRQTGLTPKRFMELL-------DRAPLGQESEPEITEHRDLFADVFRRPVTDaassssassssssaspnsvs 518
51556519  442 YSLIMEGASRQAGTNARQFMAAL-------QQAPLGHD-EPGAADHSDLFADVDIRPAQPssgssaslstp--------- 504
61660157  429 SELVGEGVAKRAHLTPDQLSHYLsv---vsTPVEVVTDDIEDGEQEEDLFADVSVAPASP-------------------- 485
9845326   431 NGLILEGAARSLKISLEQLRHYMe-----aVPDGAGAAVVADGEEDADLFADVEVRRPAP-------------------- 485
14251023  441 HRLILEGAARQVQMLPQQLERYLet---vtTPLPVVEDTPP---PSALLFADVNLRPIRF-------------------- 494
213159185 441 ACLMMEGAAQQLRMTPEQIKAYAynkelvaSAEVETTVTEDVLEPEDPLFANVSRRHVRQ-------------------- 500
20026628  543 sdyg--------------tgasssgvtftrptttaafytspsSRMDLERAPRQRRRMVSVEPFSPYSVAynqhrhQRRRR 608
52139221  519 lpsarssstrtttpastytsagtssttglllsssslsgshgiSSADLEQPPRQRRRMVSVTLFSPYSVAysh-hrRHRRR 597
51556519  505 -------------------------------stssapsgqpsPSRLGPEQPPRQRRYLSLSNFSPYSVA------RHHHR 547
61660157  486 ----------------------------------------------VRPIRGGGQRMANMRGARPYSTV------QRGRR 513
9845326   486 ------------------------------------------------TRPARGSRFANLKGAKPYSAT--------GRR 509
14251023  495 ------------------------------------------------RPDGPRRRFRSVAGLRPYSVGrrpsgaRASGV 526
213159185 501 ------------------------------------------SSKRHHGKMQGKSHRTQIPNLRPYQIT------KPKRH 532
20026628  609 RPPPPAPRGPAHTRYQGPDTeRTPYRGDDDEDPRDGLAETL 649
52139221  598 RSPPPAPRGPAHTRFQGPDSmPSTSYGSDVEDPRDDLAENL 638
51556519  548 RRRPRPPRGPAHTSRQGPDI-AASASASGGEDPRDSLAEEL 587
61660157  514 RHESEV----------------------------------- 519
9845326   510 RGAVEGTRETSL----------------------------- 521
14251023  527 RASGPRASTAASSSAAGPGSpSGSESVSELHDLTERFRDAL 567
213159185 533 RPDVTAKLSKQLQQASISDS--------------------- 552
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap