Conserved Protein Domain Family
PHA03244

?
PHA03244: PHA03244 
large tegument protein UL36; Provisional
Statistics
?
PSSM-Id: 177567
View PSSM: PHA03244
Aligned: 3 rows
Threshold Bit Score: 664.731
Threshold Setting Gi: 9845327
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20026638   1 MDDLRDTLLSYGCIAVRAEDFNSLNEFLDQECGARLHVPWPERCYIQLRSRSALGPFVGKMGTVCSQGAYVCCQEYMHPI 80 
52139222   1 MDDLRDTLMAYGCIAIRAGDFNGLNDFLEQECGTRLHVAWPERCFIQLRSRSALGPFVGKMGTVCSQGAYVCCQEYLHPF 80 
9845327    3 YLGCGDISGYYAWLADAGFDRDRIRKHVSDKCGSLLPLSWPDGVSVMLMDVRTISRFARVADAVCLGGRYVCCCEEFAPI 82 
20026638  81 GFLEGPGFMRYQIIVLVGKRGGVYCYDDLHDCVYELAATMKEFLRVGFRNCDVFYTMRDYQRPMVEYDDYWNSIMLYRSD 160
52139222  81 GFVEGPGFMRYQLIVLIGQRGGIYCYDDLRDCIYELAPTMKDFLRHGFRHCDHFHTMRDYQRPMVQYDDYWNAVMLYRGD 160
9845327   83 GRLFGSVIEKNRFVVLYGSTGGVYCYDLQEDCVYQLGDSLQSFFCDGLRRMDAVYDLPV-ALPRMLIDGVMASLMEAEST 161
20026638 161 VESMSAEIARRGYRSYVIDDPFDECPDTHFAFWTHDGEVMKFKENSFSVVTGGGVIQTMELMIHTVPRISCYHQLLGALG 240
52139222 161 VESLSAEVTKRGYASYSIDDPFDECPDTHFAFWTHNTEVMKFKETSFSVVRAGGSIQTMELMIRTVPRITCYHQLLGALG 240
9845327  162 AVFTSIVAANQG-SIYPVSDNLAGVDNQFMLYRGTHGTVTS--------CSLGTTVNLTTVMCNVVKRMSCAFEIIGALG 232
20026638 241 HEVIERREFIVRQYVLIDNFGTVYGYDPAADAVYRLAEDVVMFTCVMGKKGYRNHRFSTRREALVRLEKTPVCQHPKKTP 320
52139222 241 HEVPERKEFLVRQYVLVDTFGVVYGYDPAMDAVYRLAEDVVMFTCVMGKKGHRNHRFSGRREAIVRLEKTPTCQHPKKTP 320
9845327  233 YKVAT-AVFHPRLFVLMDPLGAVYGFDNCLNRIYRLADSFKIFTRIVSQKSLFNFRHDPGTRGARRLEKIPHCPHVCNVR 311
20026638 321 DPMAMFEDDDEADQPPq--------------------PRRIPSHEEAEGRICDAILESMLASAKMVLSD----------- 369
52139222 321 DPMIMFDEDDDDELSL---------------------PRNVMTHEEAESRLYDAITENLMHCVKLVTTD----------- 368
9845327  312 E--IALDPDSNFDIEPqyisrnpsdsfslarfvsfgePIGHDAFVGRKNRFFDPSRINRNQCSEGFVTDvvchyeaallm 389
20026638 370 -------SHIATHMWPQELKALADN--SSVMHLCAtategDVEAVRQKILGKVGTLNHFELSF-----RFQDDEPETYMG 435
52139222 369 -------SPLATHLWPQELQALCDS--PALSLCTD-----DVEGVRQKLRARTGSLHHFELSY-----RFHDEDPETYMG 429
9845327  390 raayfdhRQITDKLWPDEVDALLNGhpPCLPMARDprvreALEKMRA-------------MSIvdddpDLDREDTRAAIG 456
20026638 436 FLWDMPPCERCVRRRRYKVCDAGRRDLIPPGANVMAPLTPPHV 478
52139222 430 FLWDIPSCDRCVRRRRFKVCDVGRRHIIPGAANGMPPLTPPHA 472
9845327  457 ----DPPCRRCIEGRREALFNRLR---------GK-------- 478
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap