Conserved Protein Domain Family
PHA03242

?
PHA03242: PHA03242 
envelope glycoprotein M; Provisional
Statistics
?
PSSM-Id: 177566
View PSSM: PHA03242
Aligned: 8 rows
Threshold Bit Score: 396.52
Threshold Setting Gi: 9629865
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
83722578   1 MGRSSSRAS---AAPAGGEPVSRAAWWAWCVQVGAFVVSVLCLLGLLIAAHFFRAAFPCFYASAASYGSANDTAEvrGGV 77 
30984438   1 MGRPASRGP---AATEGDEPVSRAAWWTWCVQVGAFVVSALCLVGLLIVAHFFREGFPCFYASAASYGPANDTAEvrGGV 77 
9629390    1 MGRPAPRGSpdsAPPTKGMTGARTAWWVWCVQVATFVVSAVCVTGLLVLASVFRARFPCFYATASSYAGVNSTAEvrGGV 80 
9629279    1 MGRRAPRGSpeaAPGADVAPGARAAWWVWCVQVATFIVSAICVVGLLVLASVFRDRFPCLYAPATSYAKANATVEvrGGV 80 
56694732   1 MGRQSSRAS---AAPAGGEPVSRAAWWAWCVQVGAFVVSVLCLLGLLIAAHFFRAAFPCFYASPASYGPANDTAEvrGGV 77 
51557531   1 --------------MCGPRNAEAVSWRSWLIEVCGFALAALTLVLTLIFASLPEMGFPCFYATVADYDTLNDTS---GGV 63 
9629865    1 --------------MAGSAQPAAVHWRLWLAQVGVFAGLALLLLITLIGAASPGAGLPCFYAAIVNYNARNLSAD--GGA 64 
9625925   10 SEKVSPYDTttpEVEALDHQMDTLNWRIWIIQVMMFTLGAVMLLATLIAASSEYTGIPCFYAAVVDYELFNATLD--GGV 87 
83722578  78 ---------AAPPRLDAQSLVGVYAVTATLLLATAAYAVAGATTARYRRR---QNAAELDAATRMVVTHATLLGGNACLW 145
30984438  78 ---------AAPPRLDAQSLVGTYAVTATLMLAVAAYVVVGATTARYRRR---QDAAELDAAARMVATHATLLGGNACVW 145
9629390   81 ---------AVPLRLDTQSLVGTYVITAVLLLAVAVYAVVGAVTSRYDRA---LDAGRRLAAARMAMPHATLIAGNVCSW 148
9629279   81 ---------AVPLRLDTQSLLATYAITSTLLLAAAVYAAVGAVTSRYERA---LDAARRLAAARMAMPHATLIAGNVCAW 148
56694732  78 ---------AAPPHLDAPSLVGVYAVTATLLLAAAAYAVVGATTARYRRR---QDAAELDAATRMVVTHATLVGGNACLW 145
51557531  64 wtrq--plvAPALFLETPTVTSFFGFTATVLLAHALYAVAGAVVLRREAGrlaFQPSVVLYAASTVAAPGTLMLGALCAW 141
9629865   65 waqrelgarHPALFLETPTTAAFSAYTAVVLLAVAAFDVAAAIIIRRENSggfAAAYHMNALATLATPPGALLLGALAAW 144
9625925   88 wsgnrggysAPVLFLEPHSVVAFTYYTALTAMAMAVYTLITAAIIHRETKn--QRVRQSSGVAWLVVDPTTLFWGLLSLW 165
83722578 146 LLQVTVLLLAHRVSALAHTVYVLHFACLTYFAAHFCTRGVLSGTYLRQVHGLADVAPAHHRVVGPVRAVMTNALLFGALL 225
30984438 146 LLQITVLLLAHSVSALAHTVYVLHFACLTYFAAHFCTRGVLSGTYLRQVHGLMDVAPTHHRIVGPVRAVMTNAMLFGALL 225
9629390  149 LLQITVLLLAHRISQLAHLVYVLHFACLVYFAAHFCTRGVLSGTYLRQVHGLMELAPTHHRVVGPARAVLTNALLLGVFL 228
9629279  149 LLQITVLLLAHRISQLAHLIYVLHFACLVYLAAHFCTRGVLSGTYLRQVHGLIDPAPTHHRIVGPVRAVMTNALLLGTLL 228
56694732 146 LLQVTVLLLAHRVSALAHTVYVLHFACLTYFAAHFCTRGVLSGTYLRQVHGLADAAPAHHRVVGPVRAVMTNALLFGALL 225
51557531 142 TLQAVVLLMAHKQAGLAAAAYITHFVFLALFGACHACKGT------GDVRAALAASPPLRRVAVHARAVVTNVVLGAVGL 215
9629865  145 TLQAAVLLLSHKIMVLAAATYLAHLAPPAAFVGLFCTAGLPGAEYAQAVHALRERSPRAHRLLGPGRAVMINLAGGLLAL 224
9625925  166 LLNAVVLLLAYKQIGVAATLYLGHFATSVIFTTYFCGRGKLDETNIKAVANLRQQSVFLYRLAGPTRAVFVNLMAALMAI 245
83722578 226 CTATAAVSVATIAALNFPLSAPGVLVCLTTTFAALVVLLLALVEGLLSHYVRVLLGPHVGAIAAAGIVGVAAERYYTQGY 305
30984438 226 CTAPAAVSVATIAALNFPLSAPGVLVCLAAAFAALVVLLLAVVEGLLSHYVRVLLGPHVGAIAAAGIVGVTAERYYTNGY 305
9629390  229 CTADAAVSLNTIAAFNFNFSAPGMLICLTVLFAILVVSLLLVVEGVLCHYVRVLVGPHLGAVAATGIVGLACEHYYTNGY 308
9629279  229 CTAAAAVSLNTIAALNFNFSAPSMLICLTTLFALLVVSLLLVVEGVLCHYVRVLVGPHLGAIAATGIVGLACEHYHTGGY 308
56694732 226 CTATAAVSVATIAALNFPLSAPGVLVCLTATFAALVVLLLALVEGLLSHYVRVLLGPHVGAIAAAGVVGVAAERYYAQGY 305
51557531 216 GAAVVGLMLGVLLANSFHISLWKTAEAALAVFTLLALALMVFVEVVVSGYVQVLPTPAFCVLVASAAFGVSAHRYFAK-F 294
9629865  225 IIGTAPLMLGQLLGAGLGLSLAQTVVAGVTVFCLAAVLFLVLTELVLSRYTQVLPGPAFGTLVAASCIAVASHDYFHQLR 304
9625925  246 CILFVSLMLELVVANHLHTGLWSSVSVAMSTFSTLSVVYLIVSELILAHYIHVLIGPSLGTLVACATLGTAAHSYMDRLY 325
83722578 306 YVAEAQWPGAQTGVRVALALVALFALAMAVVRCVRAYLYHREHRTKFFRHVRDTKHRARSAIRRVRGSMRAARggdpgpa 385
30984438 306 YVAETQWPGAQTGVRVTLALVAFFALVMAGVRCVRAYLYHREHRTRFFRHMRDTKHRARSAIRRVRGSMRAARggdpgpa 385
9629390  309 YVVETQWPGAQTGVRVALALVAAFALGMAVLRCTRAYLYHRRHHTKFFMRMRDTRHRAHSALKRVRSSMRGSRdgrhrpa 388
9629279  309 YVVEQQWPGAQTGVRVALALVAAFALAMAVLRCTRAYLYHRRHHTKFFVRMRDTRHRAHSALRRVRSSMRGSRrggppg- 387
56694732 306 YVAEAQWPGAQTGVRVALALVALFALVMAAVRCVRAYLYHREHRTRFFRHVRDARHRARSAIRRARGSMRAARggdpgga 385
51557531 295 SEALGETHGVVIGTRAVLAVLSLIALAMIVVRLVRACIAHRARGSRFYANVDKARTTARRYLQKRLHGRGND-------- 366
9629865  305 GVVRTQAPRAAARVKLALAGVALLAVAMLVLRLVRACLHHRRKGSAFYGHVSAARQQAARYIARARSSRG---------- 374
9625925  326 DPISVQSPRLIPTTRGTLACLAVFSVVMLLLRLMRAYVYHRQKRSRFYGAVRRVPERVRGYIRKVKPAHRNSR------- 398
83722578 386 rpgaplepvyaEIKYAGESDVGRdDDDSEYTEGEPIYDEVAS--------DVEEVTYARIQHrprvvee----------- 446
30984438 386 rpgaalepiysEVKYAGESDVGR-DDDSEYTEGEHIYDEVAS--------DPEDVTYARIQHrprpvedpedvtyariqh 456
9629390  389 pgsppgipeyaEDPYAISYGGQ--LDRYGDSDGEPIYDEVAD--------DQTDVLYAKIQHprhlpdddpiydtvgg-y 457
9629279  388 ------dpgyaETPYASVSHHAE-IDRYGDSDGDPIYDEVAP--------DHEAELYARVQRpgpvpdaepiydtveg-y 451
56694732 386 ----pvepvyaEIRYAGESDVGR-DDDSEYTEGEPIYDEVAS--------DAEEVTYARIQHhprrvee----------- 441
51557531 367 ------------------------EYLLAPGSGDDEFD------------DGDEVVYENLGFe----------------- 393
9629865  375 -----------MAPLEGDAAALL-DRGVASDDEEAVYEAHAPprpptiplRRPEVPHSRASHprppprspppahvk---- 438
9625925  399 ------------------------RTNYPSQGYGYVYENDSTye----tdREDELLYERSNS------------------ 432
83722578 447 -------piyetvgEW 455
30984438 457 rprpveepiydtvrEW 472
9629390  458 dpepaedpvystvrRW 473
9629279  452 aprsagepvystvrRW 467
56694732 442 -------piyetvgEW 450
51557531     ----------------    
9629865      ----------------    
9625925  433 --------------GW 434
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap