Conserved Protein Domain Family
PHA03239

?
PHA03239: PHA03239 
envelope glycoprotein M; Provisional
Statistics
?
PSSM-Id: 177565
View PSSM: PHA03239
Aligned: 2 rows
Threshold Bit Score: 615.095
Threshold Setting Gi: 38638247
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
155042202   4 PKSLRFSKKkpheivedrqdvQSEMNVLSWRIWLTEALMFTLGAVMFLLAIIMASVEFTGLPCFYAAVVDYElFNATLDG 83 
38638247    1 MGNYYYGGQ------------ESRLERISWRMWMVEAACYIVLVLLTLVSSFASLSSTTGFPCFVGTVGESS-FGGDLMG 67 
155042202  84 GVWAGNKGYGAPVLFLEPRSILAFTYYKAVVMLAVAIYVIASAISIHRQgkNHYELRPCYNIARMIATPTTLFLGLFSLW 163
38638247   68 HGMTPARRDGVKIFFMSSPSTLFVVFSAVFVWLVVAVYLLLGGVRVKMC--NFDSSYGASELSSAVATMTSLVTLSITAW 145
155042202 164 LEHAVLILLAYKQVGIAGTVYVGQFITFVLFTGCFFGRGKISDVNDK-ELDIREYGNVLYRLVGPARAVFVNLVGALMSI 242
38638247  146 AWQVFVLMLSYRQLTLAAVAFVGIFIAGLVFMLSFASGGKSPENYATfNSQLKTVCKDVHAVITAFKAVVLNLFCVVFGV 225
155042202 243 DILITCLMLELVVANHSHLDLWSSVSTALSMFTVMSIIYLVVAELTVAHYVHVLIGPSLGTLISCATLGTAAHAYMDRLy 322
38638247  226 WHLMLVMLGAVIMVLNFGVSIPKATTGALVVFIVLGLVYLMMIELVVSRYVHVLLGPHLGMIIALGIAGTSALSYAETL- 304
155042202 323 DPITIQSPRLIqgTRGTLACLAVLSIVMLIVRVTRAYLYHRKKNSRFYGQVKRVPQKVRGYLQKFKSHRHSRYKYVDTRP 402
38638247  305 DEIMYASWKPV--AAGILGAFSVIVLALAVLRAVRSYKFHKAAQSKFLQQVASVAQTVKNRARRERNGPRVHKRYYDAVP 382
155042202 403 L-TYANLPRDNIPfeYSTYETDMDDDIYE 430
38638247  383 VdAYEDDPYRQSP--RRSRHGEAEDVIYE 409
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap