Conserved Protein Domain Family
PHA03234

?
PHA03234: PHA03234 
DNA packaging protein UL33; Provisional
Statistics
?
PSSM-Id: 177562
View PSSM: PHA03234
Aligned: 2 rows
Threshold Bit Score: 540.295
Threshold Setting Gi: 51874235
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
224020399   1 MDTVIELSKLLRNEEFKGNASCTsTPTLKTARIMESAVTGITLTTSIPMIIIVVTTMILYHRVAKHNATSFYVITLFASD 80 
51874235    1 MDTLIDFQKILHDEEYKYNYTCI-TPTVRKAQRLESVINGIMLTLILPVSTVVICTLLIYYKWTKQTITSPYLITLFISD 79 
224020399  81 FVLMWCVFFMTVNRKQLFSFNRFFCQLVYFIYHAVCSYSISMLAIIATIRYKTLHRRKKTESKTSSTGRNIGILLLASSM 160
51874235   80 SLHSLTVLLLTLNREALTNLNQALCQCVLFVYSASCTYSLCMLAVISTIRYRTLQRRTLNDKNNNHIKRNVGILFLSSAM 159
224020399 161 CAIPTALFVKTNGMKKT-GKCVVYISSKKAYELFLAVKIVFSFIWGVLPTMVFSFFYVIFCKALHDVTEKKYKKTLFFIR 239
51874235  160 CAIPAVLYVQVEKKKGNyGKCNIHISTQKAYDLFIGIKIVYCFLWGIFPTVIFSYFYVIFGKTLRALTQSKHNKTLSFIS 239
224020399 240 ILLLSFLLIQIPYIAILICEIAFLYMPQNTCFWLARVEILQLIIRLMPQVHCFSNPLVYAFTGGELRNRFTacfqSFFPK 319
51874235  240 LLILSFLCIQIPNLLVMSVEIFFLYIANTSCLGTIQREIVQIISRLMPEIHCLSNPLVYAFTRTDFRLRFY----DFIKC 315
224020399 320 TLCSTQKRKDSDASEHDQ 337
51874235  316 NLCNSSLKRKRNPLTIKN 333
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap