Conserved Protein Domain Family
PHA03225

?
PHA03225: PHA03225 
DNA packaging protein UL33; Provisional
Statistics
?
PSSM-Id: 165486
View PSSM: PHA03225
Aligned: 2 rows
Threshold Bit Score: 222.629
Threshold Setting Gi: 57790958
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
38638223   1 MASLIgagtAARLDRVIPEQELAERPLSELFRDYVESAPERRYEVWFFNVTPPEMELALPTTDAKLNYLAHTANLASAVR 80 
57790958   1 MASTV----PRRLSELVDEEELAERPLSELFRKYIGSAGSPVYEIWFYDLSPPEIEVALPTTDAKLNYLAHTANVAAELR 76 
38638223  81 YDcagDTDGGR-CVHARLLERRRERFAKILNKFLDLHQILGTIQQ 124
57790958  77 YR---NLDGKRmCAHAELIARRRERFAQILSKFLDLHQILGALEP 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap