Conserved Protein Domain Family
PHA03222

?
PHA03222: PHA03222 
single-stranded binding protein UL29; Provisional
Statistics
?
PSSM-Id: 165485
View PSSM: PHA03222
Aligned: 2 rows
Threshold Bit Score: 667.804
Threshold Setting Gi: 20026632
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20026632  16 MSVPNRVRRARRKRSLAPETFCARDLADLCVRRDYEGLRRYLLRFEGACVSLGWPSQCFYVVGGSHSPYLLTEIDLEHCQ 95 
51556510   1 MGDESRPRLVRRKRAAAPETFCSRSLSELCMRRDSEGLKRYLMRFEGSCVSLGWPAQCAFVVGGMYSPYAITEIDLEHCQ 80 
20026632  96 NDFFGEFRDMHLIGVVSYAACRYPVFVDAHGAVFAYDAQEDCLYELASDLGGFFAKGMIRCDPVHESICARLQPGVSLVH 175
51556510  81 NDFFGESRVLQPLGTVSHYTNKYPVFLDPCGAVIVYDAKEDCLYEVASDLNDFFIRGMIRCDPVHETICRRMQPDVSPLS 160
20026632 176 PDHKAELCRRSRVSARGRYLRSLLCFRELLACGDDpQARSAYVESHRDAQLILTWPERHHLLVRNAQDLGLTASALRRFQ 255
51556510 161 SAQKVEMCERSRISTRERYLHSLLCFRQLLDCPDN-EHRSQYVEEHRNAKLSLIWPENHYVLVANAQDLEMSPIAIRRLQ 239
20026632 256 RSLYTREPLTALGEIEGPEGKTFFNHVKILCGDTGAVYAALVGHDKLVKLARDLKAFVRVGLALLIDDFRYENIGPIDHT 335
51556510 240 RFSYGREPILLLGVIEGEGNKTFFQRVKVFCGDSGIVYVALVGQERLTRIARDLKTFVRIGLCPLIDDYRYENIGPVDRH 319
20026632 336 SLHEVNPELKLPFKKRR 352
51556510 320 TLYELYPGTTLPFKKRR 336
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap