Conserved Protein Domain Family
PHA03219

?
PHA03219: PHA03219 
nuclear protein UL24; Provisional
Statistics
?
PSSM-Id: 165484
View PSSM: PHA03219
Aligned: 3 rows
Threshold Bit Score: 574.096
Threshold Setting Gi: 51556502
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51556502   6 MSDIESLAMSVEFGLGCVEAYVRLNSGQKIALPWPRGWYLVLQELEADDDYTAEDIRRLSYYLCCQTRLAFLGRVVGEPV 85 
20026626   1 MTDLASLALTAEFGLGCLEAYVRINNNHEIPVAWPPGWSLVLQEPEVDEEFKPEDVKAWSYYLCCETRLAFVGRIIGEPV 80 
52139210   1 MSDLASLALTAEFGLGCLEAYVRINAGQVLPVVWPPGWNLVLQEIETDEDFKPEDVKAWSHYLCCQTRLAFVGRFVNEGV 80 
51556502  86 LVHGQRKTTLIILVSEEGQVFCYVEEDFSLYYVAKNLSELQRVGLRAVDVLYCPRHIRSSALKRSFRRIRNAWKSGPEAV 165
20026626  81 LSPDQQKKTIAFLVSEDGYVFCYVREDDAVYFIARNLMEFARTGLRAVESLHCLRYLGSSLVKRYFRPLRRAWSLGFDAV 160
52139210  81 LSPDQQKKTAVCLISDEGYVFCYVREDTAVYYLARNLMEFARVGLRAVETLHCMRYLTSSLVKRYFRPLLRAWSLGLDTM 160
51556502 166 SRYVTRNHGNYLQLPYPEGACLRLCNLKCFEVTSTSGFMLRSLRSHFGDQVICLGTVDLKGEMPSSPcYVRWPVTRVPIV 245
20026626 161 ARFIIRNHGELLPLTYPPGAELRLCNLKCFESCVDGGHLLRAIKESFGSRVIGLGTVNLKGEQTPFP-YLRWPPERVPIV 239
52139210 161 ARFIIRHHGQFMPLTYPPGTELRLCNLRCFENSVEGGHLLRNIKTAFGMRVLGLGTVSLKGENAPFP-HLRWPVDLIPIV 239
51556502 246 LVDGGRVFCLDLVNLRYIRLADDLTAFMCLGLRQLLNNRRFTGDCELHDTVPECPRGRQHN 306
20026626 240 ISYTGGVYACDIRSEQYIRLGDNLCMFMCLGLNLLFENRRFSGHNGVHDRVPDCPKGRQHH 300
52139210 240 VAYTGAVYACDVRDDRYIRVGDNLNTFMCLGLNLLFENRRFSGHNGIYDRVPDCPKGRQHR 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap