Conserved Protein Domain Family
PHA03216

?
PHA03216: PHA03216 
nuclear protein UL24; Provisional
Statistics
?
PSSM-Id: 177558
View PSSM: PHA03216
Aligned: 3 rows
Threshold Bit Score: 452.927
Threshold Setting Gi: 270339475
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9629764     1 MKRKQRLTARSRLRAGIRCHNRFYNAMVQDLASAKKNGVYGARLAPLFSELVPAETLKTAMGVSLAFEVNLGQRRPDCVC 80 
50313279    1 MKRRQRLTARSRLRAGIRCHNRFYNAMVQDLASAKRNGVYGERLAPLFSELVPAETLKTALGVSLAFEVNLGQRRPDCVC 80 
270339475   2 MKREQRRSVGLRLRAGIRCHNRFYAVLKRDISSTSASGVYTDRLECLLGGSVSAESLKKAKGVYLACEVNLGRRRPDCVC 81 
9629764    81 TVQFGHGSDAKGVCILIELKTCRFSKNMNTASKNLQRKGGMRQLHDSCRLLAKTLPPGSGEILLAPVLVFVAQRGMRVLR 160
50313279   81 TVQFGKGSDAKGVCILIELKTCRFSKNMNTASKNLQRKGGMRQLHDSCRLLARTLPPGSGEIVLAPVLVFVAQRGMRVLR 160
270339475  82 TIQF--EGEGGGICFLIELKTCRFSKNMDTTSKDIQRREGLKQLTDSVGLITKILPPGGEKLTLIPILAFIAQRGLRILG 159
9629764   161 VTRLSPQVVYSNAAVLSCTISRLAEYSPPISERSTRRRCVTRRTNSKAFRAKTTTGSIQPITQAKPAATAAVASLFSATA 240
50313279  161 VTRLSPQVVYSNAAVLSCTISRLAEYAPPVSAKSTRRRCVAKGTKAKAFSTKAAAEPVPSITPAQPSAAAAVVSLFPAAV 240
270339475 160 VTSLPPQMLTSNISVLAANITKLAEYNPIESGGVIRSKKKSK-------------------YPRSGSGVYKHTNHVPMSS 220
9629764   241 QANTTNAAVGYQPATISLANPLAWVASLFAPK 272
50313279  241 PANTTNAAAVHQPVAVSHVNPLAWAASLFSPK 272
270339475 221 CVSVKDKKNTLTPIGSGESNPLKWVASLFPDH 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap