Conserved Protein Domain Family
PHA03214

?
PHA03214: PHA03214 
nuclear protein UL24; Provisional
Statistics
?
PSSM-Id: 165479
View PSSM: PHA03214
Aligned: 3 rows
Threshold Bit Score: 423.201
Threshold Setting Gi: 51874271
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9628351    1 MSLTGLPDIRKKIGQFHHLRIYKQILSLQGNFARLNYFLGDVFPANLRSASVSVFFEVRLGPRIPDCIVLLKSVDAKDEF 80 
9633120    1 MSLTGLPDIRKKIGQFHHLRIYKQILSLQGNFARLNYFLGDVFPANLRSASVSVFFEVRLGPRIPDCIVLLKSVDAKDEF 80 
51874271   1 MSLEYLPPVRRRIGQYNHLRIYKKILLLKSNFEKLNFFLGNLFPEELHDSKIHVYFEVRLGCRIPDCIIVFRHFGEKLLK 80 
9628351   81 AFHCYFFEFKTTLGKSTMQSVHHNCIHQAQYLQGLRQLQQSISFLDQYLIADEVSWNVVPVICFFRQWGLKLDFFKKFSG 160
9633120   81 AFHCYFFEFKTTLGKSTMQSVHHNCIHQAQYLQGLRQLHQSISFLDQYLIADEVLWNVVPVICFFRQWGLKLDFFKKFSG 160
51874271  81 TFHCYFFEFKTTFAKSNLFSIQKNRTQKIQYLQGLRQLRQATDYLQQFVIKNESLCKVNPVICFFRQHGLKLDFVKTFIA 160
9628351  161 KTKRLSFSFIRDLFARSQDGAVQSLLSIPNYTNFRRACQKHTDLYRKRCRKAPKSVLTKTSGENRSRASRQVAKNAPKNR 240
9633120  161 KTKRLSFSFICDLFARSQDGAVQSLLSIPNYTNFRRACQKHTDLYRRRYQKASKSVLTKTSGENRSRASRQVAKNAPKNR 240
51874271 161 KELQLSSTFLCNLFTKYQNDTVKSILSISNPTNFRRACQKYSNLYRGRYATTPKLGNSKTSKRKRRNSKKQDFKKLVKN- 239
9628351  241 IRRTAKKDAKRQ 252
9633120  241 IRRTAKKDAKRQ 252
51874271     ------------    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap